Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

X0BX41

Protein Details
Accession X0BX41    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
31-50KPREKLTKAQEEKRKNHKVPBasic
NLS Segment(s)
PositionSequence
43-45KRK
Subcellular Location(s) nucl 13.5, mito_nucl 13.5, mito 12.5
Family & Domain DBs
Amino Acid Sequences MCQKSSYERRCEDCHMRVMISVVTHQVCGGKPREKLTKAQEEKRKNHKVPYRKDDFICKLRIRPQTKYWSYIGAHTCMRCSLQKLRKEAEEELKALVDGNGMESEINLKKERLKRLKEEMMDTGLPPKDYKKALPKAIEVNMKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.54
3 0.48
4 0.43
5 0.39
6 0.32
7 0.24
8 0.2
9 0.17
10 0.15
11 0.15
12 0.14
13 0.15
14 0.14
15 0.19
16 0.23
17 0.25
18 0.28
19 0.34
20 0.43
21 0.43
22 0.49
23 0.52
24 0.58
25 0.59
26 0.65
27 0.69
28 0.69
29 0.76
30 0.79
31 0.81
32 0.74
33 0.75
34 0.75
35 0.75
36 0.76
37 0.76
38 0.73
39 0.67
40 0.66
41 0.65
42 0.63
43 0.59
44 0.55
45 0.48
46 0.44
47 0.48
48 0.55
49 0.51
50 0.5
51 0.51
52 0.55
53 0.55
54 0.54
55 0.47
56 0.43
57 0.38
58 0.39
59 0.33
60 0.25
61 0.24
62 0.21
63 0.2
64 0.16
65 0.17
66 0.13
67 0.16
68 0.23
69 0.29
70 0.34
71 0.38
72 0.4
73 0.42
74 0.45
75 0.45
76 0.43
77 0.38
78 0.34
79 0.3
80 0.27
81 0.24
82 0.2
83 0.16
84 0.08
85 0.06
86 0.06
87 0.05
88 0.05
89 0.05
90 0.05
91 0.09
92 0.11
93 0.14
94 0.14
95 0.15
96 0.23
97 0.3
98 0.41
99 0.46
100 0.51
101 0.57
102 0.65
103 0.72
104 0.69
105 0.66
106 0.59
107 0.54
108 0.48
109 0.41
110 0.37
111 0.3
112 0.28
113 0.24
114 0.24
115 0.25
116 0.27
117 0.34
118 0.39
119 0.46
120 0.53
121 0.57
122 0.59
123 0.61
124 0.65