Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

X0BVN9

Protein Details
Accession X0BVN9   
Localization Confidence High
Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
11-36ILACVLCQQRKKKCDRKSPCSFCIKAHydrophilic
39-62ECIPSTPAPKRTRRKPTKELLARLHydrophilic
NLS Segment(s)
PositionSequence
48-53KRTRRK
Subcellular Location(s) nucl 19.5, cyto_nucl 12, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MAPEQQRPPRILACVLCQQRKKKCDRKSPCSFCIKAKIECIPSTPAPKRTRRKPTKELLARLERCEELLKRCTCVQKSLMYDALATGTGSESSSPADSNSSPPPESEKTSVSSPDERHQAVYH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.47
3 0.5
4 0.53
5 0.59
6 0.63
7 0.69
8 0.75
9 0.75
10 0.78
11 0.81
12 0.85
13 0.86
14 0.88
15 0.88
16 0.85
17 0.84
18 0.76
19 0.69
20 0.69
21 0.64
22 0.55
23 0.5
24 0.48
25 0.43
26 0.41
27 0.39
28 0.33
29 0.31
30 0.36
31 0.36
32 0.4
33 0.43
34 0.52
35 0.59
36 0.64
37 0.73
38 0.75
39 0.8
40 0.8
41 0.82
42 0.83
43 0.81
44 0.77
45 0.73
46 0.72
47 0.64
48 0.57
49 0.5
50 0.39
51 0.32
52 0.3
53 0.24
54 0.19
55 0.25
56 0.24
57 0.24
58 0.28
59 0.33
60 0.31
61 0.33
62 0.32
63 0.3
64 0.33
65 0.33
66 0.32
67 0.27
68 0.25
69 0.21
70 0.19
71 0.13
72 0.1
73 0.07
74 0.05
75 0.05
76 0.06
77 0.06
78 0.05
79 0.07
80 0.07
81 0.08
82 0.08
83 0.1
84 0.11
85 0.15
86 0.2
87 0.23
88 0.22
89 0.23
90 0.29
91 0.3
92 0.34
93 0.34
94 0.31
95 0.3
96 0.33
97 0.36
98 0.34
99 0.37
100 0.36
101 0.39
102 0.43
103 0.41