Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

X0BGF5

Protein Details
Accession X0BGF5    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
22-42DEDWGHKKKNCEKYDNKRECTBasic
99-123CKGPCEWKPVKHKGECKNKKKHDGYBasic
NLS Segment(s)
Subcellular Location(s) nucl 11, mito 6, cyto 6, cyto_mito 6
Family & Domain DBs
Amino Acid Sequences MKLNLATVACVLLGFASALPGDEDWGHKKKNCEKYDNKRECTEKRNHHRCEWVPKYECVKKGRKHDSYGSEYGSEYGSEYGSGYGNDWKVCSARDWKHCKGPCEWKPVKHKGECKNKKKHDGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.04
3 0.04
4 0.04
5 0.05
6 0.06
7 0.06
8 0.07
9 0.07
10 0.1
11 0.16
12 0.21
13 0.24
14 0.27
15 0.35
16 0.43
17 0.53
18 0.57
19 0.61
20 0.67
21 0.74
22 0.83
23 0.84
24 0.79
25 0.74
26 0.75
27 0.71
28 0.68
29 0.67
30 0.66
31 0.68
32 0.74
33 0.72
34 0.7
35 0.73
36 0.7
37 0.71
38 0.66
39 0.63
40 0.56
41 0.55
42 0.58
43 0.54
44 0.55
45 0.51
46 0.53
47 0.51
48 0.57
49 0.63
50 0.6
51 0.6
52 0.6
53 0.6
54 0.58
55 0.54
56 0.46
57 0.37
58 0.32
59 0.28
60 0.22
61 0.16
62 0.1
63 0.08
64 0.06
65 0.06
66 0.06
67 0.06
68 0.06
69 0.06
70 0.07
71 0.1
72 0.11
73 0.11
74 0.11
75 0.12
76 0.12
77 0.13
78 0.16
79 0.21
80 0.28
81 0.37
82 0.46
83 0.5
84 0.59
85 0.63
86 0.63
87 0.63
88 0.66
89 0.64
90 0.66
91 0.67
92 0.66
93 0.71
94 0.78
95 0.79
96 0.77
97 0.78
98 0.78
99 0.83
100 0.86
101 0.86
102 0.87
103 0.88