Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

X0B4D3

Protein Details
Accession X0B4D3    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
6-28FSSGRPQPPMPRQPKPSRSPESIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito 12
Family & Domain DBs
Amino Acid Sequences MDNIIFSSGRPQPPMPRQPKPSRSPESISLIKTFLRALPKGEEDWDDKAPRTQEQIEQLRLDLTLRKLVREGRAKMKPKALLQSFAEEHAALLRDLESQIHSFVFIALGDVAIKSDLPVREVDEMTMAYTGAQRSAVRTLRLGVRRWIKASDTLRQSWLPRADELPLRRKSFIHIMKKIPDEDIGILREMTVEGDQAVLADVKVYIPKKQLSSSSLRIPNIIHELHGGKLSLVDIERHLAVPTASNARVGDDAHDSTNHNMMQVMEGLVVATREPVRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.62
3 0.65
4 0.72
5 0.79
6 0.85
7 0.84
8 0.84
9 0.81
10 0.78
11 0.75
12 0.71
13 0.68
14 0.64
15 0.58
16 0.49
17 0.43
18 0.37
19 0.32
20 0.27
21 0.23
22 0.24
23 0.23
24 0.24
25 0.28
26 0.3
27 0.3
28 0.31
29 0.31
30 0.28
31 0.31
32 0.33
33 0.3
34 0.28
35 0.31
36 0.31
37 0.3
38 0.32
39 0.31
40 0.3
41 0.37
42 0.43
43 0.42
44 0.4
45 0.38
46 0.33
47 0.3
48 0.27
49 0.22
50 0.17
51 0.21
52 0.2
53 0.21
54 0.23
55 0.28
56 0.35
57 0.39
58 0.43
59 0.45
60 0.54
61 0.59
62 0.61
63 0.63
64 0.6
65 0.56
66 0.6
67 0.53
68 0.49
69 0.44
70 0.45
71 0.39
72 0.34
73 0.31
74 0.21
75 0.19
76 0.15
77 0.14
78 0.09
79 0.08
80 0.07
81 0.07
82 0.08
83 0.08
84 0.08
85 0.08
86 0.09
87 0.08
88 0.08
89 0.07
90 0.07
91 0.07
92 0.05
93 0.05
94 0.04
95 0.04
96 0.04
97 0.04
98 0.04
99 0.04
100 0.04
101 0.03
102 0.07
103 0.07
104 0.08
105 0.09
106 0.11
107 0.13
108 0.13
109 0.13
110 0.1
111 0.1
112 0.09
113 0.09
114 0.07
115 0.05
116 0.06
117 0.06
118 0.05
119 0.07
120 0.06
121 0.07
122 0.13
123 0.14
124 0.14
125 0.14
126 0.16
127 0.21
128 0.25
129 0.25
130 0.26
131 0.31
132 0.32
133 0.33
134 0.32
135 0.27
136 0.31
137 0.33
138 0.33
139 0.31
140 0.31
141 0.32
142 0.32
143 0.32
144 0.31
145 0.32
146 0.27
147 0.23
148 0.23
149 0.23
150 0.26
151 0.3
152 0.33
153 0.35
154 0.36
155 0.36
156 0.35
157 0.36
158 0.41
159 0.46
160 0.46
161 0.46
162 0.48
163 0.52
164 0.55
165 0.52
166 0.43
167 0.35
168 0.27
169 0.23
170 0.21
171 0.17
172 0.14
173 0.13
174 0.12
175 0.11
176 0.1
177 0.09
178 0.06
179 0.05
180 0.05
181 0.05
182 0.05
183 0.05
184 0.05
185 0.04
186 0.04
187 0.04
188 0.04
189 0.04
190 0.09
191 0.1
192 0.13
193 0.17
194 0.21
195 0.23
196 0.26
197 0.3
198 0.3
199 0.37
200 0.38
201 0.43
202 0.46
203 0.44
204 0.42
205 0.38
206 0.37
207 0.35
208 0.3
209 0.22
210 0.19
211 0.2
212 0.19
213 0.2
214 0.17
215 0.12
216 0.12
217 0.12
218 0.11
219 0.1
220 0.11
221 0.1
222 0.12
223 0.13
224 0.13
225 0.13
226 0.12
227 0.11
228 0.12
229 0.14
230 0.18
231 0.17
232 0.19
233 0.19
234 0.2
235 0.21
236 0.19
237 0.18
238 0.18
239 0.19
240 0.19
241 0.2
242 0.21
243 0.22
244 0.26
245 0.24
246 0.19
247 0.19
248 0.18
249 0.18
250 0.17
251 0.15
252 0.1
253 0.1
254 0.09
255 0.09
256 0.09
257 0.07
258 0.09