Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

X0D1N6

Protein Details
Accession X0D1N6   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
92-116NALHRGRKLPRQARRLSRPRRLDGLBasic
NLS Segment(s)
PositionSequence
86-112RSRIKTNALHRGRKLPRQARRLSRPRR
Subcellular Location(s) nucl 12, cyto 6, mito 5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR003213  Cyt_c_oxidase_su6B  
IPR036549  Cyt_c_oxidase_su6B_sf  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0045277  C:respiratory chain complex IV  
Pfam View protein in Pfam  
PF02297  COX6B  
PROSITE View protein in PROSITE  
PS51808  CHCH  
CDD cd00926  Cyt_c_Oxidase_VIb  
Amino Acid Sequences MSDDGQELVTKPFKFVTGTDARFPNQNQTKHCWQNYVDYHKCILAKGEDFAPCRQFWLSYRSLCPSGWYQRWDEQRGMLKPSGSNRSRIKTNALHRGRKLPRQARRLSRPRRLDGLVDVVRRVRADTLQLYHL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.21
3 0.25
4 0.28
5 0.31
6 0.35
7 0.37
8 0.37
9 0.39
10 0.4
11 0.42
12 0.41
13 0.43
14 0.42
15 0.47
16 0.56
17 0.6
18 0.61
19 0.55
20 0.48
21 0.52
22 0.56
23 0.58
24 0.52
25 0.45
26 0.45
27 0.42
28 0.41
29 0.32
30 0.26
31 0.2
32 0.17
33 0.16
34 0.18
35 0.19
36 0.21
37 0.23
38 0.23
39 0.2
40 0.2
41 0.19
42 0.17
43 0.15
44 0.19
45 0.21
46 0.21
47 0.23
48 0.24
49 0.25
50 0.24
51 0.24
52 0.23
53 0.25
54 0.26
55 0.26
56 0.26
57 0.31
58 0.37
59 0.38
60 0.34
61 0.32
62 0.35
63 0.35
64 0.36
65 0.31
66 0.27
67 0.26
68 0.3
69 0.35
70 0.29
71 0.34
72 0.36
73 0.39
74 0.41
75 0.41
76 0.43
77 0.41
78 0.48
79 0.52
80 0.55
81 0.58
82 0.57
83 0.65
84 0.65
85 0.65
86 0.68
87 0.67
88 0.69
89 0.71
90 0.78
91 0.78
92 0.82
93 0.85
94 0.85
95 0.85
96 0.85
97 0.81
98 0.78
99 0.7
100 0.63
101 0.56
102 0.55
103 0.5
104 0.43
105 0.39
106 0.34
107 0.33
108 0.3
109 0.28
110 0.21
111 0.18
112 0.22
113 0.26