Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

X0BPP9

Protein Details
Accession X0BPP9   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
7-30QDELTRRRERGRRSQAAFRKRQAQHydrophilic
NLS Segment(s)
PositionSequence
13-20RRERGRRS
Subcellular Location(s) nucl 12.5, cyto_nucl 9, pero 6, cyto 4.5, mito 3
Family & Domain DBs
Amino Acid Sequences MGTVEPQDELTRRRERGRRSQAAFRKRQAQSTHALADQNARLKQNIQRLLDAARGDERPEMLGIFRDLALAAELEVPARISPDEGQPSNIGSMSGETATSDASDPRILFSDVHLPSTPSQATQYRLECSMWLDPLHYLRVSLPPQDILPYLGAGAETFAGLLFWSVMEHYQTVCTQHNSKTVIQKGLKHSKATQDIKPSFIETMAKARVEYKQTGSISQAHAVAAEKDLGLVLCSLIETEYRSTGKDPDQWLSCNGIEKRLRKTLSDDALETLRKAALGEGNAVLHYLLEDVKCRLYDSCVCFGDGPRWNVDVVDQLFTPFIRRGMEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.6
3 0.68
4 0.76
5 0.78
6 0.76
7 0.82
8 0.82
9 0.86
10 0.85
11 0.81
12 0.8
13 0.73
14 0.74
15 0.69
16 0.63
17 0.59
18 0.56
19 0.53
20 0.45
21 0.43
22 0.36
23 0.37
24 0.36
25 0.36
26 0.33
27 0.31
28 0.3
29 0.33
30 0.38
31 0.42
32 0.45
33 0.41
34 0.4
35 0.4
36 0.41
37 0.41
38 0.35
39 0.28
40 0.24
41 0.22
42 0.21
43 0.21
44 0.19
45 0.16
46 0.16
47 0.14
48 0.11
49 0.12
50 0.12
51 0.11
52 0.11
53 0.1
54 0.09
55 0.09
56 0.09
57 0.07
58 0.06
59 0.06
60 0.06
61 0.06
62 0.06
63 0.06
64 0.06
65 0.07
66 0.06
67 0.07
68 0.09
69 0.14
70 0.2
71 0.2
72 0.22
73 0.21
74 0.22
75 0.22
76 0.2
77 0.14
78 0.09
79 0.09
80 0.08
81 0.08
82 0.07
83 0.06
84 0.06
85 0.06
86 0.07
87 0.06
88 0.06
89 0.07
90 0.09
91 0.09
92 0.09
93 0.11
94 0.12
95 0.11
96 0.12
97 0.2
98 0.18
99 0.21
100 0.2
101 0.2
102 0.2
103 0.23
104 0.22
105 0.14
106 0.17
107 0.17
108 0.2
109 0.23
110 0.25
111 0.23
112 0.24
113 0.23
114 0.2
115 0.2
116 0.19
117 0.15
118 0.13
119 0.12
120 0.12
121 0.13
122 0.14
123 0.12
124 0.1
125 0.1
126 0.15
127 0.16
128 0.16
129 0.16
130 0.14
131 0.15
132 0.15
133 0.15
134 0.11
135 0.1
136 0.08
137 0.07
138 0.06
139 0.06
140 0.05
141 0.05
142 0.03
143 0.03
144 0.03
145 0.03
146 0.03
147 0.02
148 0.03
149 0.02
150 0.02
151 0.02
152 0.03
153 0.03
154 0.04
155 0.04
156 0.04
157 0.06
158 0.06
159 0.09
160 0.11
161 0.13
162 0.15
163 0.17
164 0.22
165 0.24
166 0.26
167 0.31
168 0.32
169 0.37
170 0.37
171 0.4
172 0.44
173 0.5
174 0.5
175 0.45
176 0.45
177 0.44
178 0.51
179 0.51
180 0.46
181 0.46
182 0.45
183 0.45
184 0.43
185 0.37
186 0.28
187 0.24
188 0.22
189 0.13
190 0.17
191 0.17
192 0.17
193 0.16
194 0.17
195 0.2
196 0.23
197 0.24
198 0.21
199 0.26
200 0.27
201 0.28
202 0.28
203 0.28
204 0.25
205 0.24
206 0.22
207 0.15
208 0.15
209 0.15
210 0.13
211 0.1
212 0.09
213 0.07
214 0.06
215 0.07
216 0.06
217 0.05
218 0.05
219 0.04
220 0.04
221 0.04
222 0.04
223 0.04
224 0.05
225 0.06
226 0.07
227 0.11
228 0.11
229 0.13
230 0.14
231 0.18
232 0.21
233 0.25
234 0.27
235 0.3
236 0.32
237 0.33
238 0.33
239 0.34
240 0.31
241 0.32
242 0.3
243 0.33
244 0.37
245 0.39
246 0.44
247 0.48
248 0.49
249 0.43
250 0.49
251 0.5
252 0.5
253 0.48
254 0.43
255 0.37
256 0.39
257 0.38
258 0.31
259 0.24
260 0.17
261 0.14
262 0.13
263 0.13
264 0.13
265 0.13
266 0.15
267 0.15
268 0.15
269 0.15
270 0.15
271 0.12
272 0.08
273 0.08
274 0.06
275 0.07
276 0.07
277 0.1
278 0.11
279 0.14
280 0.15
281 0.16
282 0.16
283 0.2
284 0.27
285 0.31
286 0.36
287 0.35
288 0.36
289 0.36
290 0.37
291 0.4
292 0.39
293 0.36
294 0.32
295 0.32
296 0.31
297 0.29
298 0.29
299 0.28
300 0.23
301 0.23
302 0.19
303 0.19
304 0.2
305 0.2
306 0.22
307 0.16
308 0.17