Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

X0CVR4

Protein Details
Accession X0CVR4   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
57-82PEGPCKPPAPKQKKLRMRCDARLRVVHydrophilic
NLS Segment(s)
PositionSequence
64-70PAPKQKK
Subcellular Location(s) plas 12, mito 5, extr 5, E.R. 3, cyto_mito 3
Family & Domain DBs
Amino Acid Sequences MRFLFMEIFPLSSVSLGTSIINGLVLLSLVMFSPSSPTPLTVPERRDMRAEPGRTRPEGPCKPPAPKQKKLRMRCDARLRVVPPQGQAESPHSLTFGLHLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.07
4 0.07
5 0.06
6 0.06
7 0.06
8 0.06
9 0.05
10 0.04
11 0.04
12 0.04
13 0.03
14 0.03
15 0.03
16 0.03
17 0.03
18 0.03
19 0.03
20 0.06
21 0.07
22 0.09
23 0.09
24 0.1
25 0.11
26 0.15
27 0.21
28 0.23
29 0.25
30 0.28
31 0.31
32 0.31
33 0.32
34 0.29
35 0.31
36 0.34
37 0.35
38 0.33
39 0.38
40 0.4
41 0.4
42 0.41
43 0.37
44 0.4
45 0.43
46 0.44
47 0.45
48 0.45
49 0.49
50 0.55
51 0.62
52 0.61
53 0.64
54 0.7
55 0.72
56 0.79
57 0.82
58 0.85
59 0.84
60 0.84
61 0.84
62 0.85
63 0.82
64 0.77
65 0.75
66 0.67
67 0.64
68 0.62
69 0.55
70 0.47
71 0.45
72 0.4
73 0.35
74 0.35
75 0.33
76 0.32
77 0.31
78 0.28
79 0.23
80 0.22
81 0.21