Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

X0B3T7

Protein Details
Accession X0B3T7   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
6-28FSSGRPQPPMPRQPKPSRSPESIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito 11, cyto 2
Family & Domain DBs
Amino Acid Sequences MDNIIFSSGRPQPPMPRQPKPSRSPESISLVKTFLRALPKGEEDWDDKAPRTQEQIEQLRLDLTLRKLVREGRAKMKPKALLQSFAEEHAALLRDLESQIHSFVFIALGDVAIKSDLPVREVDEMTMAYTGAQRSAVRTLRLGVRRWIKASDTLRQSWLPRADELPLRRKSFIHIMKKIPDEDIGILREMTVEGDQAVLADVKVYIPKKQLSSSSLRIPNIIHELHGGKLSLVDIERHLAVPTASNARVGDDAHDSTNHNMMQVMEGLVVATREPVRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.62
3 0.65
4 0.72
5 0.79
6 0.85
7 0.84
8 0.84
9 0.81
10 0.78
11 0.75
12 0.71
13 0.68
14 0.64
15 0.58
16 0.49
17 0.43
18 0.37
19 0.32
20 0.27
21 0.23
22 0.24
23 0.23
24 0.24
25 0.28
26 0.3
27 0.3
28 0.31
29 0.31
30 0.28
31 0.31
32 0.33
33 0.3
34 0.28
35 0.31
36 0.31
37 0.3
38 0.32
39 0.31
40 0.3
41 0.37
42 0.43
43 0.42
44 0.4
45 0.38
46 0.33
47 0.3
48 0.27
49 0.22
50 0.17
51 0.21
52 0.2
53 0.21
54 0.23
55 0.28
56 0.35
57 0.39
58 0.43
59 0.45
60 0.54
61 0.59
62 0.61
63 0.63
64 0.6
65 0.56
66 0.6
67 0.53
68 0.49
69 0.44
70 0.45
71 0.39
72 0.34
73 0.31
74 0.21
75 0.19
76 0.15
77 0.14
78 0.09
79 0.08
80 0.07
81 0.07
82 0.08
83 0.08
84 0.08
85 0.08
86 0.09
87 0.08
88 0.08
89 0.07
90 0.07
91 0.07
92 0.05
93 0.05
94 0.04
95 0.04
96 0.04
97 0.04
98 0.04
99 0.04
100 0.04
101 0.03
102 0.07
103 0.07
104 0.08
105 0.09
106 0.11
107 0.13
108 0.13
109 0.13
110 0.1
111 0.1
112 0.09
113 0.09
114 0.07
115 0.05
116 0.06
117 0.06
118 0.05
119 0.07
120 0.06
121 0.07
122 0.13
123 0.14
124 0.14
125 0.14
126 0.16
127 0.21
128 0.25
129 0.25
130 0.26
131 0.31
132 0.32
133 0.33
134 0.32
135 0.27
136 0.31
137 0.33
138 0.33
139 0.31
140 0.31
141 0.32
142 0.32
143 0.32
144 0.31
145 0.32
146 0.27
147 0.23
148 0.23
149 0.23
150 0.26
151 0.3
152 0.33
153 0.35
154 0.36
155 0.36
156 0.35
157 0.36
158 0.41
159 0.46
160 0.46
161 0.46
162 0.48
163 0.52
164 0.55
165 0.52
166 0.43
167 0.35
168 0.27
169 0.23
170 0.21
171 0.17
172 0.14
173 0.13
174 0.12
175 0.11
176 0.1
177 0.09
178 0.06
179 0.05
180 0.05
181 0.05
182 0.05
183 0.05
184 0.05
185 0.04
186 0.04
187 0.04
188 0.04
189 0.04
190 0.09
191 0.1
192 0.13
193 0.17
194 0.21
195 0.23
196 0.26
197 0.3
198 0.3
199 0.37
200 0.38
201 0.43
202 0.46
203 0.44
204 0.42
205 0.38
206 0.37
207 0.35
208 0.3
209 0.22
210 0.19
211 0.2
212 0.19
213 0.2
214 0.17
215 0.12
216 0.12
217 0.12
218 0.11
219 0.1
220 0.11
221 0.1
222 0.12
223 0.13
224 0.13
225 0.13
226 0.12
227 0.11
228 0.12
229 0.14
230 0.18
231 0.17
232 0.19
233 0.19
234 0.2
235 0.21
236 0.19
237 0.18
238 0.18
239 0.19
240 0.19
241 0.2
242 0.21
243 0.22
244 0.26
245 0.24
246 0.19
247 0.19
248 0.18
249 0.18
250 0.17
251 0.15
252 0.1
253 0.1
254 0.09
255 0.09
256 0.09
257 0.07
258 0.09