Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

X0C371

Protein Details
Accession X0C371   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MGRLLARKRPQLQKTHQRLKSGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25, cyto 1.5, cyto_nucl 1.5
Family & Domain DBs
Amino Acid Sequences MGRLLARKRPQLQKTHQRLKSGLTASRLFSLRVQILWRRVVLNFLQAYMTGALHSMNLSVPRDYTYKILILRNRLVKSTATTQKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.85
3 0.81
4 0.76
5 0.7
6 0.63
7 0.61
8 0.54
9 0.47
10 0.41
11 0.38
12 0.35
13 0.37
14 0.34
15 0.26
16 0.23
17 0.23
18 0.18
19 0.17
20 0.19
21 0.19
22 0.22
23 0.23
24 0.23
25 0.2
26 0.19
27 0.21
28 0.18
29 0.19
30 0.15
31 0.14
32 0.13
33 0.12
34 0.13
35 0.11
36 0.1
37 0.05
38 0.05
39 0.05
40 0.05
41 0.05
42 0.05
43 0.05
44 0.08
45 0.09
46 0.09
47 0.1
48 0.12
49 0.14
50 0.15
51 0.16
52 0.16
53 0.18
54 0.21
55 0.27
56 0.29
57 0.34
58 0.4
59 0.46
60 0.46
61 0.44
62 0.42
63 0.38
64 0.39
65 0.42