Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

X0CNS3

Protein Details
Accession X0CNS3    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
20-46DAPPRKTTRAPRKSGARGTNQRRDKNFHydrophilic
NLS Segment(s)
PositionSequence
5-10ARKRKA
22-71PPRKTTRAPRKSGARGTNQRRDKNFMRATNASSNKRRKVFSAEAKSRIKK
Subcellular Location(s) nucl 23.5, mito_nucl 13
Family & Domain DBs
Amino Acid Sequences MPPRARKRKASATESNGTEDAPPRKTTRAPRKSGARGTNQRRDKNFMRATNASSNKRRKVFSAEAKSRIKKHGADFVKFINKETNTRIPRISVDILKNDISPDLAGVLPWMSSSSALQRQSTQTYPRMILKALDNLQRDVRTYEDLVKQDNKIRPPDWMRWQQDTKDLEEMSKHGLAMALKMINHFIMPDLHELPPKPSEGAGGVEHVAWDLIEEVLPKMSDDTWGKIAQGHLKAFTEVLKALSAEDEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.66
3 0.56
4 0.47
5 0.4
6 0.37
7 0.34
8 0.3
9 0.31
10 0.3
11 0.35
12 0.41
13 0.5
14 0.55
15 0.6
16 0.63
17 0.68
18 0.75
19 0.8
20 0.82
21 0.79
22 0.78
23 0.79
24 0.81
25 0.83
26 0.82
27 0.81
28 0.76
29 0.76
30 0.71
31 0.71
32 0.69
33 0.64
34 0.63
35 0.57
36 0.59
37 0.6
38 0.63
39 0.6
40 0.61
41 0.65
42 0.65
43 0.67
44 0.63
45 0.56
46 0.58
47 0.6
48 0.61
49 0.63
50 0.62
51 0.65
52 0.71
53 0.73
54 0.68
55 0.63
56 0.58
57 0.52
58 0.48
59 0.5
60 0.48
61 0.45
62 0.43
63 0.43
64 0.47
65 0.42
66 0.39
67 0.37
68 0.33
69 0.33
70 0.37
71 0.41
72 0.36
73 0.38
74 0.38
75 0.32
76 0.32
77 0.33
78 0.3
79 0.26
80 0.25
81 0.25
82 0.27
83 0.26
84 0.24
85 0.2
86 0.17
87 0.12
88 0.1
89 0.07
90 0.06
91 0.05
92 0.05
93 0.05
94 0.05
95 0.04
96 0.04
97 0.05
98 0.04
99 0.04
100 0.05
101 0.08
102 0.13
103 0.15
104 0.15
105 0.17
106 0.19
107 0.21
108 0.23
109 0.23
110 0.22
111 0.22
112 0.23
113 0.24
114 0.23
115 0.2
116 0.19
117 0.17
118 0.19
119 0.2
120 0.24
121 0.23
122 0.23
123 0.25
124 0.24
125 0.23
126 0.19
127 0.17
128 0.14
129 0.14
130 0.18
131 0.2
132 0.2
133 0.22
134 0.24
135 0.24
136 0.29
137 0.32
138 0.32
139 0.32
140 0.32
141 0.36
142 0.39
143 0.44
144 0.46
145 0.52
146 0.52
147 0.55
148 0.58
149 0.52
150 0.55
151 0.5
152 0.43
153 0.38
154 0.33
155 0.27
156 0.24
157 0.24
158 0.2
159 0.19
160 0.16
161 0.11
162 0.13
163 0.12
164 0.12
165 0.14
166 0.11
167 0.1
168 0.11
169 0.12
170 0.1
171 0.1
172 0.09
173 0.08
174 0.08
175 0.09
176 0.12
177 0.14
178 0.15
179 0.18
180 0.19
181 0.21
182 0.22
183 0.21
184 0.19
185 0.16
186 0.16
187 0.15
188 0.17
189 0.15
190 0.14
191 0.14
192 0.13
193 0.12
194 0.11
195 0.09
196 0.06
197 0.06
198 0.05
199 0.05
200 0.05
201 0.06
202 0.07
203 0.08
204 0.08
205 0.08
206 0.09
207 0.09
208 0.15
209 0.17
210 0.2
211 0.23
212 0.24
213 0.24
214 0.25
215 0.28
216 0.3
217 0.33
218 0.31
219 0.3
220 0.31
221 0.31
222 0.29
223 0.28
224 0.23
225 0.18
226 0.17
227 0.16
228 0.14
229 0.14