Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

X0DCC4

Protein Details
Accession X0DCC4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
58-77TSPYRKSKSRSGVPLKPPPVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 7, plas 5, E.R. 5, golg 5, extr 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR029044  Nucleotide-diphossugar_trans  
Pfam View protein in Pfam  
PF03452  Anp1  
Amino Acid Sequences MARPMGAVRLKKTNPLTLALGAILCIFIIVFLVSPSGKSATARRFESITAEHHLSPPTSPYRKSKSRSGVPLKPPPVVHYNLNNVTITTSPIANRENVLILTPMSRFYPSYWDNLLRLTYPHELITLGFILPKTKEGNQATTELQEHIHKTQKHGREGDKFKSIIILRQDFDPAIVSQDEAERHKLKNQKARREVMSKARNSLLFTTLGPDTSWVLWLDADIIETPTTLIQDLASFDKPLIVPNCFQRYYDEEHKQMAERPYDFNSWQDSETALALAAKMGPDEILLEGYAEMPTYRMLMAYLAVEGGDRNLVIPLDGVGGTALLVKADVHRDGAMFPPFPFYHLIETEGFAKMAKRLGWQPYGLPNYKVYHYNE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.49
3 0.48
4 0.39
5 0.39
6 0.31
7 0.26
8 0.18
9 0.16
10 0.11
11 0.07
12 0.06
13 0.04
14 0.03
15 0.04
16 0.03
17 0.04
18 0.04
19 0.06
20 0.06
21 0.07
22 0.09
23 0.1
24 0.11
25 0.13
26 0.21
27 0.28
28 0.34
29 0.37
30 0.37
31 0.37
32 0.37
33 0.4
34 0.36
35 0.31
36 0.3
37 0.31
38 0.29
39 0.29
40 0.3
41 0.26
42 0.24
43 0.25
44 0.29
45 0.31
46 0.34
47 0.41
48 0.48
49 0.57
50 0.61
51 0.65
52 0.66
53 0.7
54 0.76
55 0.77
56 0.78
57 0.78
58 0.83
59 0.76
60 0.7
61 0.62
62 0.55
63 0.51
64 0.45
65 0.41
66 0.37
67 0.42
68 0.4
69 0.42
70 0.37
71 0.32
72 0.3
73 0.25
74 0.22
75 0.15
76 0.13
77 0.11
78 0.15
79 0.16
80 0.16
81 0.16
82 0.15
83 0.15
84 0.14
85 0.14
86 0.11
87 0.1
88 0.11
89 0.1
90 0.1
91 0.1
92 0.11
93 0.11
94 0.11
95 0.19
96 0.19
97 0.22
98 0.25
99 0.27
100 0.26
101 0.27
102 0.27
103 0.2
104 0.19
105 0.19
106 0.18
107 0.16
108 0.16
109 0.15
110 0.14
111 0.13
112 0.14
113 0.1
114 0.08
115 0.08
116 0.08
117 0.09
118 0.09
119 0.11
120 0.13
121 0.14
122 0.22
123 0.24
124 0.28
125 0.28
126 0.3
127 0.29
128 0.28
129 0.27
130 0.19
131 0.18
132 0.16
133 0.17
134 0.17
135 0.23
136 0.22
137 0.27
138 0.34
139 0.4
140 0.44
141 0.47
142 0.5
143 0.53
144 0.58
145 0.57
146 0.54
147 0.48
148 0.41
149 0.41
150 0.35
151 0.3
152 0.29
153 0.28
154 0.23
155 0.24
156 0.25
157 0.19
158 0.19
159 0.16
160 0.1
161 0.09
162 0.08
163 0.07
164 0.07
165 0.09
166 0.1
167 0.1
168 0.15
169 0.15
170 0.16
171 0.21
172 0.28
173 0.32
174 0.4
175 0.47
176 0.53
177 0.58
178 0.62
179 0.62
180 0.6
181 0.58
182 0.59
183 0.59
184 0.49
185 0.45
186 0.42
187 0.38
188 0.36
189 0.33
190 0.24
191 0.17
192 0.16
193 0.15
194 0.13
195 0.12
196 0.11
197 0.1
198 0.09
199 0.08
200 0.09
201 0.07
202 0.07
203 0.07
204 0.07
205 0.07
206 0.06
207 0.06
208 0.05
209 0.06
210 0.05
211 0.05
212 0.06
213 0.05
214 0.05
215 0.05
216 0.05
217 0.04
218 0.05
219 0.06
220 0.09
221 0.09
222 0.09
223 0.09
224 0.11
225 0.11
226 0.15
227 0.16
228 0.15
229 0.16
230 0.23
231 0.29
232 0.27
233 0.28
234 0.27
235 0.28
236 0.34
237 0.42
238 0.4
239 0.36
240 0.38
241 0.39
242 0.37
243 0.39
244 0.35
245 0.31
246 0.27
247 0.28
248 0.3
249 0.32
250 0.31
251 0.28
252 0.28
253 0.25
254 0.24
255 0.21
256 0.18
257 0.16
258 0.15
259 0.13
260 0.08
261 0.07
262 0.06
263 0.06
264 0.06
265 0.05
266 0.05
267 0.05
268 0.04
269 0.04
270 0.05
271 0.05
272 0.05
273 0.05
274 0.06
275 0.06
276 0.06
277 0.06
278 0.05
279 0.05
280 0.05
281 0.05
282 0.06
283 0.06
284 0.05
285 0.06
286 0.06
287 0.07
288 0.07
289 0.07
290 0.06
291 0.06
292 0.06
293 0.05
294 0.05
295 0.05
296 0.05
297 0.05
298 0.06
299 0.06
300 0.06
301 0.06
302 0.06
303 0.07
304 0.07
305 0.07
306 0.06
307 0.06
308 0.06
309 0.06
310 0.06
311 0.04
312 0.05
313 0.05
314 0.07
315 0.11
316 0.12
317 0.12
318 0.13
319 0.14
320 0.15
321 0.2
322 0.21
323 0.19
324 0.19
325 0.24
326 0.23
327 0.25
328 0.27
329 0.24
330 0.25
331 0.25
332 0.28
333 0.23
334 0.24
335 0.25
336 0.23
337 0.21
338 0.16
339 0.16
340 0.15
341 0.19
342 0.19
343 0.21
344 0.27
345 0.35
346 0.38
347 0.39
348 0.41
349 0.46
350 0.53
351 0.51
352 0.46
353 0.44
354 0.43
355 0.44