Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

X0B185

Protein Details
Accession X0B185    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MTNRKHAKHKQVQERNRIAAEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, mito 6, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
IPR002112  Leuzip_Jun  
Gene Ontology GO:0003677  F:DNA binding  
GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF00170  bZIP_1  
PROSITE View protein in PROSITE  
PS50217  BZIP  
CDD cd14687  bZIP_ATF2  
Amino Acid Sequences MTNRKHAKHKQVQERNRIAAEKCRMRKKEELARLQSDEQAIEQRHRMLSSCVDDLKEEILHLKTQLLQHTSCNCTLIHHHIEKEAQCYTDALGLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.81
3 0.74
4 0.67
5 0.58
6 0.56
7 0.56
8 0.55
9 0.56
10 0.61
11 0.6
12 0.62
13 0.67
14 0.67
15 0.68
16 0.68
17 0.69
18 0.65
19 0.67
20 0.64
21 0.58
22 0.5
23 0.4
24 0.31
25 0.22
26 0.21
27 0.17
28 0.15
29 0.15
30 0.15
31 0.15
32 0.15
33 0.15
34 0.12
35 0.14
36 0.15
37 0.16
38 0.15
39 0.15
40 0.14
41 0.14
42 0.14
43 0.11
44 0.08
45 0.09
46 0.1
47 0.1
48 0.1
49 0.1
50 0.12
51 0.14
52 0.18
53 0.19
54 0.19
55 0.23
56 0.28
57 0.3
58 0.28
59 0.27
60 0.23
61 0.22
62 0.25
63 0.28
64 0.3
65 0.31
66 0.31
67 0.33
68 0.38
69 0.38
70 0.38
71 0.33
72 0.26
73 0.23
74 0.23
75 0.21