Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C1GWK8

Protein Details
Accession C1GWK8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
152-171ASPIYSRTRREPGRKRTSWVHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 24, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR024316  APQ12  
Gene Ontology GO:0016020  C:membrane  
KEGG pbl:PAAG_02903  -  
Pfam View protein in Pfam  
PF12716  Apq12  
Amino Acid Sequences MEAVHEYIIPALQNASKYIPPSVSLQALSYYSTFNTHFYTVQQEYLQPYVISPLYTLINSPPDLPSVLILCVILYLSLRILDYARRIITFWVVLLFRLVFWGSILGGGYYVYVVGFEKASRDVGWLLGVLEGFIEEFLASSWDGKRAGTDGASPIYSRTRREPGRKRTSWV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.16
3 0.17
4 0.19
5 0.21
6 0.2
7 0.2
8 0.23
9 0.24
10 0.23
11 0.21
12 0.2
13 0.2
14 0.19
15 0.19
16 0.16
17 0.13
18 0.11
19 0.13
20 0.13
21 0.14
22 0.16
23 0.16
24 0.16
25 0.16
26 0.22
27 0.21
28 0.23
29 0.21
30 0.2
31 0.21
32 0.22
33 0.21
34 0.14
35 0.13
36 0.14
37 0.13
38 0.12
39 0.09
40 0.1
41 0.1
42 0.1
43 0.1
44 0.09
45 0.11
46 0.11
47 0.12
48 0.11
49 0.11
50 0.11
51 0.11
52 0.1
53 0.09
54 0.08
55 0.07
56 0.07
57 0.06
58 0.05
59 0.05
60 0.04
61 0.03
62 0.03
63 0.03
64 0.03
65 0.04
66 0.04
67 0.04
68 0.06
69 0.07
70 0.09
71 0.1
72 0.1
73 0.1
74 0.1
75 0.11
76 0.1
77 0.08
78 0.08
79 0.07
80 0.07
81 0.08
82 0.07
83 0.06
84 0.07
85 0.07
86 0.05
87 0.05
88 0.05
89 0.04
90 0.05
91 0.05
92 0.04
93 0.04
94 0.04
95 0.04
96 0.03
97 0.03
98 0.03
99 0.03
100 0.03
101 0.04
102 0.04
103 0.05
104 0.06
105 0.07
106 0.08
107 0.08
108 0.1
109 0.09
110 0.1
111 0.1
112 0.09
113 0.08
114 0.08
115 0.07
116 0.06
117 0.05
118 0.04
119 0.04
120 0.04
121 0.03
122 0.03
123 0.03
124 0.03
125 0.05
126 0.05
127 0.07
128 0.08
129 0.11
130 0.12
131 0.11
132 0.13
133 0.13
134 0.15
135 0.14
136 0.15
137 0.15
138 0.17
139 0.18
140 0.17
141 0.17
142 0.24
143 0.27
144 0.29
145 0.33
146 0.41
147 0.5
148 0.61
149 0.69
150 0.71
151 0.8