Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

X0CJC6

Protein Details
Accession X0CJC6   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MPPFTKDSSCRVRRKRSQENGRYLPRRRSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, mito 8, cyto 2
Family & Domain DBs
Amino Acid Sequences MPPFTKDSSCRVRRKRSQENGRYLPRRRSVKRIFVFAAVQRCTRIFYIHRPFPCPGQPSMGANTGSIARQTRHDSDGNLLHISVDILNRPWDEYVGVSRKARL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.88
3 0.89
4 0.9
5 0.9
6 0.9
7 0.89
8 0.89
9 0.87
10 0.82
11 0.79
12 0.77
13 0.77
14 0.71
15 0.72
16 0.71
17 0.73
18 0.7
19 0.67
20 0.6
21 0.53
22 0.51
23 0.44
24 0.42
25 0.33
26 0.3
27 0.25
28 0.24
29 0.23
30 0.21
31 0.2
32 0.16
33 0.24
34 0.31
35 0.36
36 0.37
37 0.39
38 0.39
39 0.38
40 0.41
41 0.34
42 0.26
43 0.25
44 0.25
45 0.23
46 0.25
47 0.25
48 0.21
49 0.18
50 0.17
51 0.14
52 0.13
53 0.13
54 0.12
55 0.1
56 0.13
57 0.18
58 0.21
59 0.24
60 0.25
61 0.25
62 0.28
63 0.31
64 0.3
65 0.25
66 0.22
67 0.18
68 0.17
69 0.16
70 0.13
71 0.1
72 0.09
73 0.1
74 0.12
75 0.13
76 0.14
77 0.14
78 0.14
79 0.14
80 0.14
81 0.22
82 0.25
83 0.29