Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

X0CJ53

Protein Details
Accession X0CJ53    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
6-33QKANLARIRDNQRRSRARRREYLQELEQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, mito 10, cyto_nucl 10, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MSTPAQKANLARIRDNQRRSRARRREYLQELEQRLRVYELQGVEASSEVQHAARRVAEENRQLRGLLNRHGISDDYITSYLHSGTASQTDPTAISHFTPNTHSDSVQSLQQVIAPRRPTALETGVSYGLPPQESREPSIASGSTSSSSIWESGQAIQPPSAYARPLPSNVPTPVPRQSITSSMHPQQYTSQMFPDPQVSRTESYHAIATPGSLMDDPRRHSYSVAPMPGDVSSTMGYSIPMNSFHNPVGQDGGPSGPC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.69
3 0.68
4 0.72
5 0.78
6 0.83
7 0.85
8 0.86
9 0.86
10 0.87
11 0.84
12 0.84
13 0.81
14 0.8
15 0.77
16 0.76
17 0.72
18 0.66
19 0.62
20 0.52
21 0.45
22 0.39
23 0.32
24 0.24
25 0.23
26 0.2
27 0.19
28 0.19
29 0.18
30 0.16
31 0.15
32 0.13
33 0.09
34 0.09
35 0.07
36 0.07
37 0.09
38 0.1
39 0.12
40 0.12
41 0.14
42 0.17
43 0.22
44 0.28
45 0.34
46 0.37
47 0.38
48 0.38
49 0.36
50 0.35
51 0.37
52 0.34
53 0.31
54 0.34
55 0.32
56 0.32
57 0.33
58 0.31
59 0.25
60 0.23
61 0.18
62 0.13
63 0.13
64 0.12
65 0.12
66 0.12
67 0.1
68 0.09
69 0.08
70 0.06
71 0.07
72 0.09
73 0.1
74 0.09
75 0.09
76 0.09
77 0.1
78 0.1
79 0.1
80 0.09
81 0.09
82 0.11
83 0.12
84 0.12
85 0.15
86 0.16
87 0.19
88 0.19
89 0.18
90 0.17
91 0.2
92 0.19
93 0.19
94 0.17
95 0.13
96 0.11
97 0.14
98 0.17
99 0.16
100 0.2
101 0.19
102 0.19
103 0.2
104 0.2
105 0.19
106 0.17
107 0.17
108 0.14
109 0.13
110 0.15
111 0.14
112 0.13
113 0.12
114 0.1
115 0.08
116 0.08
117 0.07
118 0.08
119 0.13
120 0.14
121 0.16
122 0.17
123 0.17
124 0.17
125 0.19
126 0.16
127 0.12
128 0.11
129 0.1
130 0.09
131 0.08
132 0.08
133 0.07
134 0.08
135 0.08
136 0.07
137 0.07
138 0.08
139 0.09
140 0.12
141 0.13
142 0.13
143 0.13
144 0.13
145 0.13
146 0.14
147 0.13
148 0.11
149 0.1
150 0.13
151 0.15
152 0.16
153 0.18
154 0.18
155 0.22
156 0.23
157 0.26
158 0.25
159 0.27
160 0.31
161 0.32
162 0.3
163 0.28
164 0.29
165 0.3
166 0.31
167 0.34
168 0.33
169 0.35
170 0.39
171 0.36
172 0.35
173 0.32
174 0.36
175 0.34
176 0.3
177 0.27
178 0.24
179 0.25
180 0.25
181 0.29
182 0.23
183 0.21
184 0.24
185 0.25
186 0.26
187 0.27
188 0.29
189 0.24
190 0.24
191 0.24
192 0.2
193 0.18
194 0.15
195 0.14
196 0.11
197 0.09
198 0.09
199 0.08
200 0.09
201 0.15
202 0.2
203 0.24
204 0.3
205 0.32
206 0.32
207 0.33
208 0.36
209 0.39
210 0.42
211 0.42
212 0.36
213 0.34
214 0.34
215 0.33
216 0.29
217 0.19
218 0.14
219 0.1
220 0.1
221 0.11
222 0.1
223 0.1
224 0.1
225 0.12
226 0.11
227 0.13
228 0.16
229 0.18
230 0.21
231 0.21
232 0.25
233 0.23
234 0.23
235 0.25
236 0.22
237 0.21
238 0.19