Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

X0BIY8

Protein Details
Accession X0BIY8   
Localization Confidence Medium
Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
45-70NFDDQCKPKATKRPRRSLRNITGTSPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24, mito 3
Family & Domain DBs
Amino Acid Sequences MSRMYKTGGHSRKVNYDSIEECSPDTSPSNNEVNSINPADSLYKNFDDQCKPKATKRPRRSLRNITGTSPKSGTTSPQTPDTRYKRGSETIKRFQKTNQPAIVIPSTVSEEEEKGRNDSVLRLANIITLALRLEEIGELQKVLEDAKGRTATAESKVFEAILAENNVKVAQDAVKRCIQEHFSNHRTGGIMRPYRRSVKGAQDVVKVSIEKREEAEEQAAALGLCDYIVQLYNIFKKGGPKIEQLTSILENAIHKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.49
3 0.47
4 0.43
5 0.42
6 0.4
7 0.31
8 0.29
9 0.26
10 0.23
11 0.2
12 0.2
13 0.17
14 0.18
15 0.22
16 0.26
17 0.24
18 0.26
19 0.24
20 0.25
21 0.27
22 0.26
23 0.21
24 0.16
25 0.17
26 0.19
27 0.19
28 0.2
29 0.2
30 0.2
31 0.22
32 0.25
33 0.3
34 0.35
35 0.38
36 0.4
37 0.44
38 0.46
39 0.51
40 0.59
41 0.65
42 0.68
43 0.74
44 0.79
45 0.81
46 0.88
47 0.91
48 0.91
49 0.9
50 0.89
51 0.81
52 0.74
53 0.73
54 0.64
55 0.57
56 0.47
57 0.37
58 0.29
59 0.27
60 0.27
61 0.24
62 0.27
63 0.26
64 0.34
65 0.35
66 0.36
67 0.46
68 0.49
69 0.5
70 0.47
71 0.48
72 0.44
73 0.49
74 0.54
75 0.55
76 0.57
77 0.6
78 0.66
79 0.64
80 0.61
81 0.58
82 0.6
83 0.57
84 0.56
85 0.49
86 0.42
87 0.41
88 0.44
89 0.4
90 0.3
91 0.22
92 0.15
93 0.13
94 0.11
95 0.11
96 0.08
97 0.09
98 0.1
99 0.13
100 0.13
101 0.13
102 0.13
103 0.13
104 0.13
105 0.13
106 0.15
107 0.15
108 0.14
109 0.14
110 0.13
111 0.13
112 0.13
113 0.12
114 0.07
115 0.04
116 0.04
117 0.04
118 0.03
119 0.03
120 0.03
121 0.03
122 0.04
123 0.04
124 0.04
125 0.04
126 0.04
127 0.05
128 0.04
129 0.05
130 0.06
131 0.07
132 0.07
133 0.12
134 0.13
135 0.12
136 0.13
137 0.14
138 0.14
139 0.16
140 0.19
141 0.15
142 0.15
143 0.15
144 0.15
145 0.14
146 0.12
147 0.09
148 0.09
149 0.1
150 0.09
151 0.09
152 0.09
153 0.09
154 0.09
155 0.08
156 0.06
157 0.09
158 0.14
159 0.17
160 0.2
161 0.24
162 0.24
163 0.25
164 0.28
165 0.29
166 0.29
167 0.35
168 0.41
169 0.41
170 0.43
171 0.42
172 0.4
173 0.36
174 0.31
175 0.29
176 0.29
177 0.33
178 0.34
179 0.39
180 0.43
181 0.48
182 0.5
183 0.48
184 0.44
185 0.47
186 0.53
187 0.54
188 0.53
189 0.51
190 0.5
191 0.48
192 0.44
193 0.35
194 0.27
195 0.26
196 0.24
197 0.21
198 0.21
199 0.23
200 0.23
201 0.25
202 0.27
203 0.21
204 0.19
205 0.18
206 0.17
207 0.12
208 0.1
209 0.07
210 0.05
211 0.04
212 0.04
213 0.04
214 0.04
215 0.06
216 0.06
217 0.07
218 0.12
219 0.17
220 0.19
221 0.2
222 0.21
223 0.27
224 0.33
225 0.4
226 0.41
227 0.43
228 0.46
229 0.5
230 0.51
231 0.45
232 0.44
233 0.36
234 0.32
235 0.26
236 0.22