Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

X0CDB4

Protein Details
Accession X0CDB4   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
9-34TLCERVQTMVRQRRRKEKRHMEISAPHydrophilic
NLS Segment(s)
PositionSequence
22-26RRKEK
Subcellular Location(s) nucl 21.5, cyto_nucl 14, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MHISDDFQTLCERVQTMVRQRRRKEKRHMEISAPFGFEKNPVNLPGVSEEQLSMLREHAAASRIGIADPPSPTAPRSPCSTSSLFSHPVRPPIKTVPTSTSLSSTDSLH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.24
3 0.33
4 0.42
5 0.51
6 0.59
7 0.65
8 0.75
9 0.8
10 0.83
11 0.84
12 0.85
13 0.86
14 0.87
15 0.84
16 0.79
17 0.74
18 0.7
19 0.61
20 0.51
21 0.41
22 0.31
23 0.27
24 0.22
25 0.19
26 0.16
27 0.15
28 0.15
29 0.17
30 0.16
31 0.17
32 0.18
33 0.17
34 0.15
35 0.13
36 0.12
37 0.11
38 0.11
39 0.11
40 0.09
41 0.07
42 0.07
43 0.07
44 0.07
45 0.08
46 0.08
47 0.07
48 0.07
49 0.08
50 0.08
51 0.08
52 0.08
53 0.09
54 0.1
55 0.1
56 0.12
57 0.12
58 0.13
59 0.14
60 0.19
61 0.2
62 0.2
63 0.25
64 0.27
65 0.28
66 0.33
67 0.34
68 0.3
69 0.32
70 0.34
71 0.35
72 0.32
73 0.37
74 0.35
75 0.42
76 0.42
77 0.4
78 0.4
79 0.42
80 0.49
81 0.45
82 0.46
83 0.42
84 0.44
85 0.46
86 0.42
87 0.38
88 0.31
89 0.31