Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C1GVE1

Protein Details
Accession C1GVE1    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
57-78AEGVRKARTRRGQDKVKRLDHGBasic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito 9, cyto 3
Family & Domain DBs
KEGG pbl:PAAG_02218  -  
Amino Acid Sequences MGNKVRQEREEVRKKAQEPKAVNRDGTVKTNSHRAKQTDLQSRLQHPRLLWQTEQAAEGVRKARTRRGQDKVKRLDHGQPRCPQGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.71
3 0.69
4 0.68
5 0.64
6 0.69
7 0.7
8 0.65
9 0.62
10 0.53
11 0.51
12 0.44
13 0.42
14 0.35
15 0.27
16 0.25
17 0.35
18 0.36
19 0.36
20 0.39
21 0.36
22 0.39
23 0.44
24 0.51
25 0.51
26 0.52
27 0.52
28 0.5
29 0.53
30 0.53
31 0.49
32 0.43
33 0.32
34 0.37
35 0.36
36 0.37
37 0.32
38 0.28
39 0.28
40 0.26
41 0.27
42 0.19
43 0.16
44 0.13
45 0.15
46 0.16
47 0.16
48 0.2
49 0.22
50 0.31
51 0.37
52 0.47
53 0.54
54 0.6
55 0.69
56 0.74
57 0.83
58 0.83
59 0.81
60 0.76
61 0.71
62 0.72
63 0.71
64 0.71
65 0.69
66 0.67