Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

X0BA08

Protein Details
Accession X0BA08    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
24-44NLKTHRKLHARQPNRKCRVEDBasic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 13, cyto 5.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
Amino Acid Sequences MKTEAPESFFCEVCGKNGFSRRDNLKTHRKLHARQPNRKCRVEDAQQESEAEVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.2
3 0.23
4 0.3
5 0.33
6 0.32
7 0.38
8 0.42
9 0.45
10 0.49
11 0.52
12 0.55
13 0.58
14 0.61
15 0.63
16 0.63
17 0.6
18 0.66
19 0.69
20 0.68
21 0.71
22 0.77
23 0.8
24 0.81
25 0.83
26 0.75
27 0.71
28 0.7
29 0.69
30 0.68
31 0.65
32 0.63
33 0.58
34 0.56