Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

X0B975

Protein Details
Accession X0B975    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
255-291LPQQDLKRTRLRRPVTRAQARKEKELKTTRRGRKKGFBasic
NLS Segment(s)
PositionSequence
261-291KRTRLRRPVTRAQARKEKELKTTRRGRKKGF
Subcellular Location(s) nucl 19, cyto_nucl 13, cyto 5
Family & Domain DBs
Amino Acid Sequences MPPAGNYYMRPNPSHIHLPPPPEWRPPTAIPPNAIPPIAFPPLQLWHNVIYDCMRRVLVEHGCAHTSSKPVGLSREDAETLLSTIHRTFKASIQNELSGIRTILNEKNTSSDPAATSSTITAEDIKVIRQEIQSLRDTLCLEFKALAQGQPPDLPTVLSECKLMDVTASWSTTAQALKGAVQSLERTVEDLKNMLAQDREKYWPEIEALRAEQLSAFQRGPALDTLDNPSKTAQEIKAYLQEIRGLLYGAQEVKLPQQDLKRTRLRRPVTRAQARKEKELKTTRRGRKKGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.43
3 0.44
4 0.45
5 0.49
6 0.51
7 0.55
8 0.54
9 0.53
10 0.55
11 0.51
12 0.53
13 0.5
14 0.54
15 0.55
16 0.55
17 0.49
18 0.49
19 0.51
20 0.46
21 0.43
22 0.33
23 0.26
24 0.28
25 0.28
26 0.24
27 0.19
28 0.2
29 0.24
30 0.25
31 0.24
32 0.2
33 0.2
34 0.22
35 0.22
36 0.2
37 0.19
38 0.22
39 0.22
40 0.22
41 0.19
42 0.17
43 0.18
44 0.24
45 0.23
46 0.24
47 0.26
48 0.26
49 0.27
50 0.28
51 0.28
52 0.23
53 0.22
54 0.18
55 0.18
56 0.18
57 0.18
58 0.21
59 0.22
60 0.23
61 0.22
62 0.23
63 0.21
64 0.19
65 0.18
66 0.15
67 0.13
68 0.11
69 0.1
70 0.08
71 0.09
72 0.13
73 0.13
74 0.14
75 0.16
76 0.2
77 0.29
78 0.3
79 0.33
80 0.32
81 0.33
82 0.31
83 0.3
84 0.27
85 0.18
86 0.16
87 0.12
88 0.1
89 0.12
90 0.15
91 0.17
92 0.17
93 0.16
94 0.19
95 0.19
96 0.21
97 0.19
98 0.17
99 0.15
100 0.16
101 0.17
102 0.14
103 0.13
104 0.11
105 0.11
106 0.09
107 0.09
108 0.08
109 0.06
110 0.08
111 0.08
112 0.08
113 0.09
114 0.09
115 0.11
116 0.1
117 0.14
118 0.14
119 0.18
120 0.19
121 0.19
122 0.19
123 0.19
124 0.2
125 0.16
126 0.16
127 0.13
128 0.12
129 0.11
130 0.11
131 0.12
132 0.11
133 0.11
134 0.1
135 0.11
136 0.11
137 0.12
138 0.12
139 0.09
140 0.09
141 0.09
142 0.07
143 0.1
144 0.11
145 0.1
146 0.1
147 0.09
148 0.1
149 0.1
150 0.09
151 0.06
152 0.06
153 0.08
154 0.1
155 0.1
156 0.1
157 0.1
158 0.1
159 0.12
160 0.12
161 0.08
162 0.08
163 0.08
164 0.09
165 0.09
166 0.1
167 0.08
168 0.09
169 0.09
170 0.09
171 0.1
172 0.09
173 0.1
174 0.12
175 0.12
176 0.12
177 0.12
178 0.11
179 0.12
180 0.12
181 0.12
182 0.13
183 0.13
184 0.15
185 0.18
186 0.21
187 0.2
188 0.23
189 0.22
190 0.21
191 0.22
192 0.21
193 0.2
194 0.19
195 0.18
196 0.17
197 0.16
198 0.15
199 0.13
200 0.14
201 0.14
202 0.15
203 0.14
204 0.12
205 0.14
206 0.14
207 0.16
208 0.15
209 0.16
210 0.13
211 0.15
212 0.21
213 0.27
214 0.27
215 0.25
216 0.25
217 0.22
218 0.23
219 0.26
220 0.23
221 0.21
222 0.23
223 0.25
224 0.3
225 0.31
226 0.3
227 0.26
228 0.27
229 0.22
230 0.21
231 0.19
232 0.14
233 0.12
234 0.12
235 0.14
236 0.12
237 0.12
238 0.11
239 0.12
240 0.16
241 0.19
242 0.2
243 0.22
244 0.28
245 0.38
246 0.42
247 0.5
248 0.56
249 0.59
250 0.66
251 0.72
252 0.74
253 0.75
254 0.79
255 0.81
256 0.82
257 0.86
258 0.85
259 0.84
260 0.86
261 0.8
262 0.82
263 0.79
264 0.73
265 0.73
266 0.75
267 0.74
268 0.74
269 0.8
270 0.81
271 0.84