Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

X0BRH5

Protein Details
Accession X0BRH5   
Localization Confidence High
Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
89-110QLKRIPKTYHSRRPTNGKRKAAHydrophilic
NLS Segment(s)
PositionSequence
106-106K
Subcellular Location(s) nucl 21, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009069  Cys_alpha_HP_mot_SF  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MSSSPKDTAEATEPLKSSDVDTQPWNDDKRRKFETKSKSEFYDPCQEAAQRSYRCLFRNGGDKNMCGEYFQAYRDCKQAWVRYINTMLQLKRIPKTYHSRRPTNGKRKAAAGSNGAIRSQQPALTCYIQPGSAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.28
3 0.24
4 0.22
5 0.25
6 0.25
7 0.24
8 0.26
9 0.27
10 0.3
11 0.35
12 0.37
13 0.36
14 0.42
15 0.45
16 0.51
17 0.56
18 0.58
19 0.59
20 0.65
21 0.68
22 0.7
23 0.72
24 0.68
25 0.64
26 0.63
27 0.59
28 0.55
29 0.54
30 0.45
31 0.38
32 0.36
33 0.32
34 0.28
35 0.29
36 0.32
37 0.22
38 0.23
39 0.25
40 0.28
41 0.29
42 0.31
43 0.29
44 0.24
45 0.32
46 0.32
47 0.36
48 0.33
49 0.32
50 0.31
51 0.3
52 0.27
53 0.18
54 0.17
55 0.12
56 0.11
57 0.12
58 0.14
59 0.14
60 0.15
61 0.18
62 0.18
63 0.19
64 0.24
65 0.27
66 0.28
67 0.33
68 0.33
69 0.33
70 0.35
71 0.32
72 0.32
73 0.32
74 0.27
75 0.25
76 0.28
77 0.28
78 0.29
79 0.34
80 0.31
81 0.34
82 0.44
83 0.51
84 0.58
85 0.62
86 0.67
87 0.67
88 0.76
89 0.81
90 0.81
91 0.8
92 0.78
93 0.72
94 0.69
95 0.67
96 0.62
97 0.56
98 0.48
99 0.41
100 0.39
101 0.38
102 0.33
103 0.3
104 0.24
105 0.23
106 0.21
107 0.2
108 0.16
109 0.17
110 0.22
111 0.24
112 0.24
113 0.24
114 0.24