Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

X0BLR1

Protein Details
Accession X0BLR1    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
26-47RGYKAYKAYKARKEEKKRMKAWBasic
NLS Segment(s)
PositionSequence
35-43KARKEEKKR
Subcellular Location(s) cyto 7.5, cyto_nucl 7.5, nucl 6.5, E.R. 6, extr 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSEPDVMDGIILILEGLILFINLCERGYKAYKAYKARKEEKKRMKAWMACNWDSLDNSNPRMGWEANSCQMSPLHHQNGQADYTRETILSMEVEENLLCKGLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.02
3 0.03
4 0.02
5 0.02
6 0.02
7 0.03
8 0.04
9 0.05
10 0.05
11 0.06
12 0.07
13 0.11
14 0.15
15 0.17
16 0.21
17 0.28
18 0.35
19 0.43
20 0.52
21 0.56
22 0.61
23 0.69
24 0.74
25 0.78
26 0.82
27 0.83
28 0.84
29 0.8
30 0.78
31 0.77
32 0.72
33 0.69
34 0.66
35 0.63
36 0.54
37 0.51
38 0.44
39 0.37
40 0.31
41 0.25
42 0.22
43 0.17
44 0.17
45 0.17
46 0.16
47 0.16
48 0.18
49 0.17
50 0.14
51 0.16
52 0.18
53 0.21
54 0.22
55 0.21
56 0.2
57 0.2
58 0.2
59 0.22
60 0.27
61 0.28
62 0.29
63 0.31
64 0.33
65 0.35
66 0.35
67 0.33
68 0.26
69 0.23
70 0.23
71 0.22
72 0.19
73 0.16
74 0.15
75 0.13
76 0.11
77 0.11
78 0.09
79 0.09
80 0.1
81 0.1
82 0.1
83 0.09