Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C1GNW1

Protein Details
Accession C1GNW1    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
45-73IVEPQEKKKTPKGRAKKRLQYTRRFVNVTHydrophilic
NLS Segment(s)
PositionSequence
50-62EKKKTPKGRAKKR
Subcellular Location(s) mito 19, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG pbl:PAAG_00206  -  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQTPKVSSLFIPPLQPSRARLLPSHGQKSIVEPQEKKKTPKGRAKKRLQYTRRFVNVTLTGGKRKMNPNPTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.43
3 0.48
4 0.49
5 0.5
6 0.56
7 0.52
8 0.5
9 0.44
10 0.41
11 0.37
12 0.32
13 0.31
14 0.25
15 0.27
16 0.26
17 0.27
18 0.24
19 0.25
20 0.27
21 0.27
22 0.26
23 0.28
24 0.33
25 0.39
26 0.4
27 0.35
28 0.33
29 0.32
30 0.35
31 0.36
32 0.34
33 0.31
34 0.29
35 0.36
36 0.45
37 0.49
38 0.49
39 0.51
40 0.55
41 0.6
42 0.69
43 0.73
44 0.74
45 0.81
46 0.87
47 0.89
48 0.9
49 0.91
50 0.9
51 0.89
52 0.86
53 0.85
54 0.81
55 0.73
56 0.63
57 0.6
58 0.55
59 0.48
60 0.46
61 0.4
62 0.38
63 0.38
64 0.41
65 0.39
66 0.43
67 0.49