Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W3WJW3

Protein Details
Accession W3WJW3   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
15-46IRCHAHKVRCTRPANKKRCKRCYRANVECIPRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
KEGG pfy:PFICI_15042  -  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MDDSRDEACHKPACIRCHAHKVRCTRPANKKRCKRCYRANVECIPRPSKRARDARDSPFDTEISTPGLDEDPSPAAVAKLPEDASSSSYTPDNTALHLDFDFSVDIIGHASECG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.52
3 0.53
4 0.6
5 0.68
6 0.68
7 0.67
8 0.72
9 0.73
10 0.75
11 0.75
12 0.74
13 0.76
14 0.79
15 0.83
16 0.85
17 0.86
18 0.87
19 0.91
20 0.91
21 0.88
22 0.88
23 0.88
24 0.88
25 0.88
26 0.84
27 0.81
28 0.77
29 0.73
30 0.66
31 0.6
32 0.51
33 0.46
34 0.44
35 0.44
36 0.47
37 0.52
38 0.51
39 0.56
40 0.62
41 0.64
42 0.65
43 0.6
44 0.53
45 0.45
46 0.41
47 0.32
48 0.26
49 0.2
50 0.13
51 0.11
52 0.09
53 0.08
54 0.08
55 0.07
56 0.07
57 0.08
58 0.07
59 0.08
60 0.08
61 0.07
62 0.07
63 0.08
64 0.09
65 0.08
66 0.09
67 0.1
68 0.1
69 0.12
70 0.12
71 0.13
72 0.15
73 0.15
74 0.14
75 0.15
76 0.15
77 0.15
78 0.17
79 0.15
80 0.14
81 0.17
82 0.16
83 0.17
84 0.16
85 0.16
86 0.13
87 0.14
88 0.13
89 0.09
90 0.09
91 0.07
92 0.08
93 0.07
94 0.07