Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W3XBP8

Protein Details
Accession W3XBP8    Localization Confidence High Confidence Score 20.4
NoLS Segment(s)
PositionSequenceProtein Nature
31-70PDGPWRRKVTKIKKDLIQKAKLKKAYKKIKARELPQNKQSHydrophilic
204-226EAEFQRRREERERKNAERERFQRBasic
NLS Segment(s)
PositionSequence
15-62SKKARKGGFRVGPDNLPDGPWRRKVTKIKKDLIQKAKLKKAYKKIKAR
156-159KNKP
171-180PSRRQSRNAP
193-245ASKKKAEQEAREAEFQRRREERERKNAERERFQRAMKKARTPGRDGQRKLGRE
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
KEGG pfy:PFICI_04482  -  
Amino Acid Sequences MAPKRPLDASDARDSKKARKGGFRVGPDNLPDGPWRRKVTKIKKDLIQKAKLKKAYKKIKARELPQNKQSSSSAVGVENQGHNKKRDNEDSSAEEGGEEEEEEDEASGQPDSESEMEDADAHSDNEGKEEKVKQSRDTPKSATESQQHDKHLEGKKNKPEEKQDRPDHMHPSRRQSRNAPHRPGYYDKALAEASKKKAEQEAREAEFQRRREERERKNAERERFQRAMKKARTPGRDGQRKLGRESGLLLEKARRITQQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.55
3 0.56
4 0.57
5 0.53
6 0.57
7 0.62
8 0.66
9 0.72
10 0.71
11 0.68
12 0.65
13 0.61
14 0.53
15 0.5
16 0.39
17 0.32
18 0.3
19 0.31
20 0.33
21 0.38
22 0.42
23 0.42
24 0.51
25 0.61
26 0.67
27 0.71
28 0.75
29 0.74
30 0.75
31 0.82
32 0.83
33 0.82
34 0.8
35 0.77
36 0.77
37 0.78
38 0.79
39 0.77
40 0.75
41 0.76
42 0.78
43 0.8
44 0.81
45 0.81
46 0.84
47 0.84
48 0.82
49 0.83
50 0.82
51 0.81
52 0.78
53 0.78
54 0.67
55 0.63
56 0.56
57 0.48
58 0.41
59 0.34
60 0.27
61 0.2
62 0.2
63 0.18
64 0.2
65 0.19
66 0.21
67 0.25
68 0.27
69 0.28
70 0.34
71 0.39
72 0.44
73 0.5
74 0.5
75 0.48
76 0.49
77 0.5
78 0.46
79 0.4
80 0.33
81 0.24
82 0.19
83 0.15
84 0.11
85 0.07
86 0.04
87 0.04
88 0.04
89 0.04
90 0.04
91 0.04
92 0.04
93 0.05
94 0.04
95 0.04
96 0.04
97 0.04
98 0.06
99 0.06
100 0.06
101 0.06
102 0.06
103 0.06
104 0.07
105 0.07
106 0.06
107 0.07
108 0.06
109 0.06
110 0.07
111 0.06
112 0.08
113 0.09
114 0.08
115 0.11
116 0.13
117 0.18
118 0.23
119 0.25
120 0.26
121 0.35
122 0.45
123 0.46
124 0.49
125 0.46
126 0.43
127 0.47
128 0.46
129 0.41
130 0.37
131 0.39
132 0.4
133 0.42
134 0.4
135 0.36
136 0.35
137 0.38
138 0.39
139 0.41
140 0.42
141 0.46
142 0.52
143 0.61
144 0.65
145 0.62
146 0.66
147 0.68
148 0.71
149 0.73
150 0.71
151 0.7
152 0.71
153 0.71
154 0.69
155 0.66
156 0.65
157 0.6
158 0.63
159 0.66
160 0.64
161 0.65
162 0.64
163 0.68
164 0.7
165 0.75
166 0.73
167 0.69
168 0.68
169 0.68
170 0.65
171 0.59
172 0.52
173 0.46
174 0.38
175 0.34
176 0.31
177 0.27
178 0.27
179 0.28
180 0.28
181 0.3
182 0.31
183 0.3
184 0.37
185 0.42
186 0.42
187 0.45
188 0.49
189 0.47
190 0.52
191 0.52
192 0.53
193 0.53
194 0.5
195 0.5
196 0.46
197 0.5
198 0.55
199 0.64
200 0.66
201 0.7
202 0.78
203 0.76
204 0.83
205 0.85
206 0.82
207 0.82
208 0.76
209 0.74
210 0.7
211 0.69
212 0.67
213 0.66
214 0.69
215 0.66
216 0.71
217 0.71
218 0.74
219 0.75
220 0.73
221 0.74
222 0.75
223 0.77
224 0.71
225 0.73
226 0.73
227 0.7
228 0.68
229 0.65
230 0.55
231 0.47
232 0.46
233 0.43
234 0.39
235 0.37
236 0.34
237 0.32
238 0.34
239 0.36
240 0.36