Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W3X0P8

Protein Details
Accession W3X0P8    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
116-137TSADWGKKARKRQRVMLKKLIDHydrophilic
NLS Segment(s)
PositionSequence
122-128KKARKRQ
Subcellular Location(s) cysk 10, nucl 8.5, cyto_nucl 8.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011431  Trafficking_Pga2  
Gene Ontology GO:0016020  C:membrane  
KEGG pfy:PFICI_09523  -  
Pfam View protein in Pfam  
PF07543  PGA2  
Amino Acid Sequences MSELSDLVAHLGDSLHQLFSLVTMAGERFTSNLTASFSTMTIKHWIRLVMIVGTYMLVRPYIIKFSAKYQQKQFEKAHEEDAAAAISPNQLRGQVDIPEDSDDDEVPDPEATAASTSADWGKKARKRQRVMLKKLIDAEEQRLQELQEDEEDKDIEQYLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.09
4 0.09
5 0.09
6 0.09
7 0.1
8 0.07
9 0.06
10 0.07
11 0.07
12 0.07
13 0.08
14 0.07
15 0.07
16 0.08
17 0.09
18 0.09
19 0.1
20 0.12
21 0.12
22 0.13
23 0.13
24 0.12
25 0.13
26 0.13
27 0.13
28 0.18
29 0.18
30 0.19
31 0.2
32 0.21
33 0.19
34 0.2
35 0.19
36 0.13
37 0.12
38 0.11
39 0.09
40 0.08
41 0.07
42 0.06
43 0.05
44 0.04
45 0.04
46 0.05
47 0.06
48 0.09
49 0.1
50 0.11
51 0.12
52 0.16
53 0.24
54 0.29
55 0.33
56 0.37
57 0.45
58 0.46
59 0.52
60 0.5
61 0.49
62 0.49
63 0.46
64 0.42
65 0.33
66 0.31
67 0.23
68 0.22
69 0.15
70 0.09
71 0.07
72 0.04
73 0.05
74 0.05
75 0.06
76 0.06
77 0.07
78 0.07
79 0.09
80 0.11
81 0.12
82 0.13
83 0.12
84 0.13
85 0.13
86 0.13
87 0.12
88 0.11
89 0.09
90 0.09
91 0.09
92 0.08
93 0.08
94 0.08
95 0.07
96 0.07
97 0.07
98 0.05
99 0.06
100 0.06
101 0.05
102 0.05
103 0.06
104 0.1
105 0.11
106 0.11
107 0.15
108 0.24
109 0.29
110 0.4
111 0.49
112 0.56
113 0.62
114 0.71
115 0.79
116 0.81
117 0.84
118 0.83
119 0.78
120 0.71
121 0.7
122 0.62
123 0.56
124 0.48
125 0.45
126 0.42
127 0.38
128 0.35
129 0.3
130 0.28
131 0.27
132 0.25
133 0.21
134 0.19
135 0.21
136 0.21
137 0.23
138 0.23
139 0.19
140 0.19