Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W3X8D4

Protein Details
Accession W3X8D4   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
17-36KPNPAKTKKGARVAKPKKATBasic
NLS Segment(s)
PositionSequence
9-47KAFASKPVKPNPAKTKKGARVAKPKKATSAAKIQKKYSA
67-89IGKGRDRSGAKKETEQKGGSKKF
Subcellular Location(s) mito 13, nucl 10, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR019034  UPF0390  
KEGG pfy:PFICI_07276  -  
Pfam View protein in Pfam  
PF09495  DUF2462  
Amino Acid Sequences MAQGTVKPKAFASKPVKPNPAKTKKGARVAKPKKATSAAKIQKKYSAGLVHKTEKLLGERAGHLEMIGKGRDRSGAKKETEQKGGSKKFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.62
3 0.7
4 0.67
5 0.75
6 0.76
7 0.78
8 0.73
9 0.71
10 0.73
11 0.72
12 0.78
13 0.75
14 0.73
15 0.75
16 0.78
17 0.81
18 0.78
19 0.71
20 0.66
21 0.65
22 0.59
23 0.52
24 0.53
25 0.52
26 0.53
27 0.54
28 0.51
29 0.48
30 0.46
31 0.42
32 0.35
33 0.33
34 0.27
35 0.3
36 0.33
37 0.33
38 0.32
39 0.32
40 0.29
41 0.24
42 0.24
43 0.21
44 0.19
45 0.17
46 0.17
47 0.19
48 0.18
49 0.16
50 0.14
51 0.14
52 0.13
53 0.14
54 0.15
55 0.14
56 0.14
57 0.15
58 0.21
59 0.22
60 0.27
61 0.32
62 0.38
63 0.4
64 0.49
65 0.58
66 0.59
67 0.64
68 0.6
69 0.6
70 0.63