Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W3WIT3

Protein Details
Accession W3WIT3    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MGTSLEKTRKRIAKKKGPIEAIHHydrophilic
NLS Segment(s)
PositionSequence
8-21TRKRIAKKKGPIEA
26-50SRDSKRLGRAQHRDEKLGKVAAARK
Subcellular Location(s) nucl 15.5, cyto_nucl 11.5, cyto 6.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR021346  Tma16  
IPR038356  Tma16_sf  
KEGG pfy:PFICI_14724  -  
Pfam View protein in Pfam  
PF11176  Tma16  
Amino Acid Sequences MGTSLEKTRKRIAKKKGPIEAIHQYSRDSKRLGRAQHRDEKLGKVAAARKRNDQPWLDRAAYFQEAVKQNQGKPLQLETVRDLIAGFVHQYDDELNDLKKARRPGRPASTKEDLLKVKINVLEKEYQSGFLTPETTTEEDALRLERWEGSWAYLTGMKWVRITSDGNTQPSSFPPRGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.85
3 0.85
4 0.84
5 0.76
6 0.74
7 0.73
8 0.68
9 0.62
10 0.53
11 0.46
12 0.47
13 0.49
14 0.46
15 0.39
16 0.37
17 0.42
18 0.48
19 0.55
20 0.57
21 0.62
22 0.67
23 0.73
24 0.73
25 0.69
26 0.65
27 0.6
28 0.54
29 0.46
30 0.37
31 0.32
32 0.36
33 0.38
34 0.43
35 0.41
36 0.44
37 0.49
38 0.52
39 0.54
40 0.52
41 0.5
42 0.47
43 0.51
44 0.45
45 0.38
46 0.35
47 0.32
48 0.29
49 0.23
50 0.18
51 0.19
52 0.21
53 0.22
54 0.27
55 0.26
56 0.25
57 0.32
58 0.33
59 0.28
60 0.27
61 0.27
62 0.26
63 0.24
64 0.25
65 0.2
66 0.21
67 0.19
68 0.17
69 0.15
70 0.1
71 0.09
72 0.08
73 0.06
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.05
80 0.05
81 0.06
82 0.06
83 0.08
84 0.1
85 0.12
86 0.15
87 0.23
88 0.29
89 0.35
90 0.41
91 0.48
92 0.56
93 0.64
94 0.64
95 0.64
96 0.62
97 0.58
98 0.54
99 0.51
100 0.42
101 0.36
102 0.36
103 0.29
104 0.27
105 0.27
106 0.29
107 0.24
108 0.26
109 0.28
110 0.24
111 0.27
112 0.24
113 0.23
114 0.2
115 0.2
116 0.18
117 0.13
118 0.14
119 0.11
120 0.12
121 0.14
122 0.14
123 0.14
124 0.14
125 0.14
126 0.13
127 0.14
128 0.15
129 0.12
130 0.11
131 0.11
132 0.11
133 0.11
134 0.14
135 0.14
136 0.14
137 0.16
138 0.16
139 0.17
140 0.2
141 0.19
142 0.22
143 0.25
144 0.25
145 0.23
146 0.23
147 0.23
148 0.23
149 0.26
150 0.22
151 0.29
152 0.33
153 0.35
154 0.37
155 0.36
156 0.34
157 0.37
158 0.42