Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0A2V6R5

Protein Details
Accession A0A0A2V6R5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
44-63INKGRQWKDIRHRYIQKAEEHydrophilic
NLS Segment(s)
Subcellular Location(s) E.R. 9, plas 8, golg 5, mito 2, cyto 1, extr 1, vacu 1, mito_nucl 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR008027  QCR9  
IPR036656  QCR9_sf  
Gene Ontology GO:0005750  C:mitochondrial respiratory chain complex III  
GO:0006122  P:mitochondrial electron transport, ubiquinol to cytochrome c  
KEGG pbl:PAAG_11213  -  
Pfam View protein in Pfam  
PF05365  UCR_UQCRX_QCR9  
Amino Acid Sequences MAGLTVYLSVLFRRNAVFLSSMFVGAFVFEIAFDSISDRIFDSINKGRQWKDIRHRYIQKAEEEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.15
4 0.15
5 0.12
6 0.15
7 0.14
8 0.13
9 0.12
10 0.11
11 0.09
12 0.08
13 0.08
14 0.04
15 0.03
16 0.03
17 0.04
18 0.04
19 0.04
20 0.04
21 0.05
22 0.06
23 0.06
24 0.07
25 0.06
26 0.07
27 0.07
28 0.07
29 0.13
30 0.2
31 0.25
32 0.28
33 0.31
34 0.32
35 0.4
36 0.46
37 0.5
38 0.54
39 0.59
40 0.63
41 0.7
42 0.78
43 0.78
44 0.81
45 0.77