Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W3XPG8

Protein Details
Accession W3XPG8    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
7-38GKDLTPSESKRRRRASKMKSRKLERDKGKEVEBasic
NLS Segment(s)
PositionSequence
15-35SKRRRRASKMKSRKLERDKGK
Subcellular Location(s) nucl 25.5, cyto_nucl 13.5
Family & Domain DBs
KEGG pfy:PFICI_01240  -  
Amino Acid Sequences MTRHEVGKDLTPSESKRRRRASKMKSRKLERDKGKEVEFHFKAGSSAPHTTGHHKLENPREKAKRTRVSSEAPTDKDEHLVEPSSKKAKTSDVEDLTPRMRTASLKGSEATSLTRIKEELDVYRDTCFVASMRIPGVFMIEILDLTTRKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.52
3 0.58
4 0.67
5 0.74
6 0.8
7 0.86
8 0.87
9 0.89
10 0.91
11 0.92
12 0.92
13 0.91
14 0.91
15 0.9
16 0.89
17 0.88
18 0.86
19 0.83
20 0.79
21 0.72
22 0.67
23 0.61
24 0.61
25 0.51
26 0.43
27 0.36
28 0.3
29 0.28
30 0.23
31 0.22
32 0.16
33 0.17
34 0.17
35 0.2
36 0.22
37 0.26
38 0.31
39 0.32
40 0.31
41 0.32
42 0.37
43 0.44
44 0.51
45 0.51
46 0.54
47 0.55
48 0.57
49 0.63
50 0.66
51 0.65
52 0.6
53 0.61
54 0.56
55 0.56
56 0.55
57 0.54
58 0.49
59 0.41
60 0.39
61 0.35
62 0.31
63 0.28
64 0.24
65 0.17
66 0.14
67 0.14
68 0.13
69 0.12
70 0.16
71 0.18
72 0.18
73 0.18
74 0.19
75 0.22
76 0.24
77 0.28
78 0.33
79 0.31
80 0.33
81 0.33
82 0.34
83 0.3
84 0.28
85 0.23
86 0.15
87 0.13
88 0.13
89 0.15
90 0.21
91 0.22
92 0.23
93 0.23
94 0.23
95 0.23
96 0.23
97 0.21
98 0.16
99 0.16
100 0.15
101 0.16
102 0.15
103 0.16
104 0.18
105 0.19
106 0.2
107 0.21
108 0.23
109 0.23
110 0.24
111 0.23
112 0.2
113 0.18
114 0.14
115 0.11
116 0.12
117 0.12
118 0.13
119 0.14
120 0.14
121 0.14
122 0.13
123 0.15
124 0.12
125 0.11
126 0.1
127 0.09
128 0.08
129 0.09
130 0.11