Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W3WX23

Protein Details
Accession W3WX23    Localization Confidence High Confidence Score 21.5
NoLS Segment(s)
PositionSequenceProtein Nature
15-39VTPRSRYTRSPSPAPRRRRSPSYSDHydrophilic
44-74RRNGRYRSESRSRSRTRTRSPSRDRDSRARSBasic
255-276RSPSYSRSRFPQPRRARSPSYGHydrophilic
NLS Segment(s)
PositionSequence
23-74RSPSPAPRRRRSPSYSDASPGRRNGRYRSESRSRSRTRTRSPSRDRDSRARS
184-292PGPRGAFGGGPRGPRGGVGSGGGGGGGGGGFGGPGFGGGPAGGRPRSPPRYGGGRQGRGRGREGNTYRPGSRSPSYSRSRFPQPRRARSPSYGSRSRSPQRRGGGRRDS
Subcellular Location(s) nucl 25.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR034201  RNPS1_RRM  
IPR000504  RRM_dom  
Gene Ontology GO:0005634  C:nucleus  
GO:0003723  F:RNA binding  
KEGG pfy:PFICI_10462  -  
Pfam View protein in Pfam  
PF00076  RRM_1  
PROSITE View protein in PROSITE  
PS50102  RRM  
CDD cd12365  RRM_RNPS1  
Amino Acid Sequences MDSRSPSRERYARSVTPRSRYTRSPSPAPRRRRSPSYSDASPGRRNGRYRSESRSRSRTRTRSPSRDRDSRARSGSPLRGSTKIVVEKLTKNINEEHLREIFGQYGSIRDLDLPMNRQFNTNRGTAYILYVNEADAEEAIAHMHEAQLDGAIINVSIVLPRRKFSQSPPTASRGANIDPRVPAPGPRGAFGGGPRGPRGGVGSGGGGGGGGGGFGGPGFGGGPAGGRPRSPPRYGGGRQGRGRGREGNTYRPGSRSPSYSRSRFPQPRRARSPSYGSRSRSPQRRGGGRRDSLDNARDSRRRSPSYDDYRSRSRSRGGRDYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.72
3 0.73
4 0.75
5 0.74
6 0.7
7 0.69
8 0.68
9 0.68
10 0.67
11 0.69
12 0.72
13 0.76
14 0.79
15 0.83
16 0.85
17 0.84
18 0.86
19 0.85
20 0.81
21 0.79
22 0.78
23 0.75
24 0.69
25 0.65
26 0.63
27 0.61
28 0.6
29 0.58
30 0.57
31 0.55
32 0.57
33 0.58
34 0.62
35 0.63
36 0.62
37 0.64
38 0.67
39 0.7
40 0.74
41 0.77
42 0.74
43 0.76
44 0.81
45 0.82
46 0.81
47 0.84
48 0.85
49 0.86
50 0.88
51 0.89
52 0.87
53 0.87
54 0.84
55 0.83
56 0.79
57 0.77
58 0.72
59 0.64
60 0.6
61 0.57
62 0.57
63 0.52
64 0.51
65 0.46
66 0.43
67 0.42
68 0.4
69 0.4
70 0.37
71 0.33
72 0.3
73 0.31
74 0.32
75 0.34
76 0.38
77 0.32
78 0.31
79 0.32
80 0.36
81 0.37
82 0.35
83 0.35
84 0.29
85 0.3
86 0.28
87 0.26
88 0.21
89 0.16
90 0.15
91 0.11
92 0.11
93 0.1
94 0.1
95 0.09
96 0.07
97 0.09
98 0.1
99 0.12
100 0.15
101 0.18
102 0.21
103 0.21
104 0.24
105 0.24
106 0.26
107 0.27
108 0.24
109 0.21
110 0.19
111 0.2
112 0.17
113 0.18
114 0.16
115 0.13
116 0.13
117 0.12
118 0.11
119 0.1
120 0.09
121 0.07
122 0.05
123 0.05
124 0.03
125 0.03
126 0.03
127 0.03
128 0.03
129 0.03
130 0.03
131 0.03
132 0.03
133 0.03
134 0.03
135 0.04
136 0.03
137 0.03
138 0.03
139 0.03
140 0.02
141 0.02
142 0.02
143 0.03
144 0.05
145 0.09
146 0.1
147 0.11
148 0.14
149 0.17
150 0.19
151 0.24
152 0.33
153 0.35
154 0.41
155 0.44
156 0.44
157 0.45
158 0.43
159 0.38
160 0.3
161 0.27
162 0.25
163 0.23
164 0.21
165 0.18
166 0.19
167 0.2
168 0.18
169 0.18
170 0.16
171 0.2
172 0.18
173 0.18
174 0.19
175 0.17
176 0.18
177 0.16
178 0.2
179 0.17
180 0.18
181 0.18
182 0.17
183 0.17
184 0.16
185 0.17
186 0.11
187 0.1
188 0.09
189 0.08
190 0.08
191 0.08
192 0.07
193 0.05
194 0.04
195 0.03
196 0.02
197 0.02
198 0.02
199 0.01
200 0.02
201 0.02
202 0.02
203 0.02
204 0.02
205 0.02
206 0.02
207 0.03
208 0.03
209 0.03
210 0.05
211 0.08
212 0.09
213 0.09
214 0.13
215 0.23
216 0.29
217 0.3
218 0.32
219 0.33
220 0.42
221 0.44
222 0.51
223 0.51
224 0.54
225 0.56
226 0.61
227 0.62
228 0.56
229 0.57
230 0.54
231 0.48
232 0.49
233 0.5
234 0.51
235 0.52
236 0.54
237 0.51
238 0.46
239 0.45
240 0.41
241 0.4
242 0.38
243 0.38
244 0.42
245 0.49
246 0.51
247 0.54
248 0.53
249 0.61
250 0.66
251 0.67
252 0.69
253 0.72
254 0.78
255 0.83
256 0.84
257 0.81
258 0.77
259 0.78
260 0.77
261 0.75
262 0.72
263 0.68
264 0.67
265 0.69
266 0.72
267 0.72
268 0.69
269 0.68
270 0.7
271 0.75
272 0.76
273 0.77
274 0.78
275 0.75
276 0.73
277 0.7
278 0.66
279 0.62
280 0.6
281 0.55
282 0.5
283 0.52
284 0.53
285 0.53
286 0.56
287 0.59
288 0.59
289 0.58
290 0.62
291 0.64
292 0.7
293 0.75
294 0.73
295 0.7
296 0.74
297 0.77
298 0.73
299 0.67
300 0.65
301 0.63
302 0.65