Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W3WIM0

Protein Details
Accession W3WIM0   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
23-59GESPMRSPKRRLPKRRLPKRRLPKRKRVSTQDHDPRWBasic
NLS Segment(s)
PositionSequence
27-49MRSPKRRLPKRRLPKRRLPKRKR
Subcellular Location(s) nucl 20.5, mito_nucl 13.333, cyto_nucl 12.166, mito 4
Family & Domain DBs
KEGG pfy:PFICI_14701  -  
Amino Acid Sequences MASPSFRPRYPAREVVIARESAGESPMRSPKRRLPKRRLPKRRLPKRKRVSTQDHDPRWDDDARRDRDHQRDHDKLRKPWHRFKAKFLSSIQWGFERFGMSRSLKGIVIVPSLAENMSGSTIFEVESSRDAKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.52
3 0.5
4 0.44
5 0.36
6 0.3
7 0.27
8 0.19
9 0.19
10 0.14
11 0.11
12 0.15
13 0.24
14 0.29
15 0.31
16 0.36
17 0.43
18 0.54
19 0.64
20 0.7
21 0.72
22 0.77
23 0.85
24 0.91
25 0.94
26 0.91
27 0.91
28 0.92
29 0.93
30 0.93
31 0.92
32 0.92
33 0.92
34 0.93
35 0.91
36 0.89
37 0.88
38 0.84
39 0.85
40 0.84
41 0.76
42 0.68
43 0.61
44 0.53
45 0.47
46 0.42
47 0.32
48 0.3
49 0.36
50 0.38
51 0.39
52 0.42
53 0.44
54 0.49
55 0.54
56 0.53
57 0.53
58 0.55
59 0.59
60 0.64
61 0.65
62 0.63
63 0.67
64 0.69
65 0.68
66 0.71
67 0.74
68 0.76
69 0.71
70 0.74
71 0.75
72 0.69
73 0.66
74 0.58
75 0.52
76 0.46
77 0.45
78 0.38
79 0.29
80 0.27
81 0.23
82 0.22
83 0.19
84 0.15
85 0.15
86 0.19
87 0.18
88 0.18
89 0.19
90 0.2
91 0.18
92 0.18
93 0.2
94 0.16
95 0.16
96 0.15
97 0.13
98 0.12
99 0.12
100 0.12
101 0.09
102 0.07
103 0.06
104 0.08
105 0.07
106 0.07
107 0.07
108 0.07
109 0.07
110 0.08
111 0.08
112 0.09
113 0.13