Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W3WWL5

Protein Details
Accession W3WWL5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
9-28FQAREKFTRKFRKLPLTTKDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14.5, mito_nucl 9.833, cyto 8.5, cyto_nucl 6.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR019189  Ribosomal_L27/L41_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
KEGG pfy:PFICI_10261  -  
Pfam View protein in Pfam  
PF09809  MRP-L27  
Amino Acid Sequences MWPTTRLMFQAREKFTRKFRKLPLTTKDINKGFYKGNRTGSMGRHTRFGGYIIEWDKVRTYVVPEGMDSFKLSPFVTNKVQRTRGQYEGYARGPSDPQLYLERWKDENGLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.64
3 0.69
4 0.67
5 0.67
6 0.7
7 0.74
8 0.77
9 0.8
10 0.77
11 0.73
12 0.72
13 0.69
14 0.69
15 0.6
16 0.55
17 0.48
18 0.43
19 0.41
20 0.4
21 0.41
22 0.37
23 0.4
24 0.39
25 0.4
26 0.41
27 0.4
28 0.42
29 0.42
30 0.37
31 0.34
32 0.33
33 0.3
34 0.26
35 0.24
36 0.17
37 0.11
38 0.15
39 0.14
40 0.15
41 0.14
42 0.14
43 0.13
44 0.12
45 0.12
46 0.08
47 0.1
48 0.11
49 0.13
50 0.13
51 0.12
52 0.15
53 0.15
54 0.15
55 0.13
56 0.11
57 0.1
58 0.11
59 0.11
60 0.11
61 0.13
62 0.17
63 0.24
64 0.3
65 0.36
66 0.42
67 0.48
68 0.49
69 0.55
70 0.56
71 0.54
72 0.5
73 0.48
74 0.46
75 0.47
76 0.45
77 0.39
78 0.34
79 0.3
80 0.28
81 0.27
82 0.24
83 0.19
84 0.19
85 0.22
86 0.24
87 0.3
88 0.33
89 0.36
90 0.34
91 0.35