Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W3WTU7

Protein Details
Accession W3WTU7    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
8-33TGGDTNTKKVKKRRSKANRTTSITCEHydrophilic
NLS Segment(s)
PositionSequence
15-23KKVKKRRSK
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 3
Family & Domain DBs
KEGG pfy:PFICI_11149  -  
Amino Acid Sequences MCSTTATTGGDTNTKKVKKRRSKANRTTSITCEQATQDHEIRAVGAQFTYYGPNSPGSCHDLPELDTNICLDKEDDLKFSSDTYDGCF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.43
3 0.5
4 0.6
5 0.64
6 0.72
7 0.79
8 0.82
9 0.88
10 0.91
11 0.93
12 0.92
13 0.88
14 0.82
15 0.76
16 0.69
17 0.6
18 0.49
19 0.39
20 0.3
21 0.25
22 0.23
23 0.22
24 0.18
25 0.16
26 0.16
27 0.15
28 0.14
29 0.13
30 0.11
31 0.07
32 0.05
33 0.04
34 0.05
35 0.05
36 0.07
37 0.07
38 0.07
39 0.08
40 0.11
41 0.11
42 0.12
43 0.14
44 0.19
45 0.19
46 0.2
47 0.2
48 0.18
49 0.2
50 0.23
51 0.23
52 0.16
53 0.16
54 0.15
55 0.16
56 0.15
57 0.14
58 0.11
59 0.11
60 0.15
61 0.17
62 0.18
63 0.18
64 0.2
65 0.2
66 0.19
67 0.19
68 0.16