Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W3XC74

Protein Details
Accession W3XC74    Localization Confidence Low Confidence Score 5.3
NoLS Segment(s)
PositionSequenceProtein Nature
6-29MDEKRPFPSRTRSFRRNRPLLNTIHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 14, golg 3, mito 2, extr 2, E.R. 2, nucl 1, cyto 1, cyto_nucl 1, pero 1, vacu 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR004911  Interferon-induced_GILT  
Gene Ontology GO:0016020  C:membrane  
GO:0016671  F:oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor  
KEGG pfy:PFICI_04627  -  
Pfam View protein in Pfam  
PF03227  GILT  
Amino Acid Sequences MGLPLMDEKRPFPSRTRSFRRNRPLLNTIIIAVLLFLVYTFRPFTGYGSVTVSFRTGQTSSFHETDDSESATTSTVKGLVPLEAHIMSKCPDARDCLRDMVLPTMMRVNSKVNFTLSFIGKPTDSNDGIACKHGPNECMGNIIELCAAHHYPDPKIYLGFVMCLTRDYKLIPQRELIEDCALEHAVDFELLNDCATKDDGAFGISLLRDSVKRSSDVRLPYFNQLLCGLASSLWNIC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.62
3 0.7
4 0.72
5 0.77
6 0.85
7 0.89
8 0.88
9 0.85
10 0.83
11 0.79
12 0.73
13 0.66
14 0.57
15 0.46
16 0.37
17 0.29
18 0.2
19 0.14
20 0.1
21 0.05
22 0.04
23 0.03
24 0.04
25 0.04
26 0.06
27 0.07
28 0.07
29 0.09
30 0.1
31 0.12
32 0.16
33 0.17
34 0.17
35 0.2
36 0.21
37 0.19
38 0.19
39 0.18
40 0.13
41 0.13
42 0.15
43 0.12
44 0.12
45 0.14
46 0.18
47 0.23
48 0.23
49 0.23
50 0.2
51 0.21
52 0.22
53 0.21
54 0.18
55 0.13
56 0.12
57 0.12
58 0.12
59 0.11
60 0.09
61 0.07
62 0.07
63 0.07
64 0.09
65 0.09
66 0.09
67 0.09
68 0.09
69 0.11
70 0.1
71 0.11
72 0.1
73 0.1
74 0.1
75 0.13
76 0.13
77 0.13
78 0.13
79 0.18
80 0.22
81 0.24
82 0.25
83 0.24
84 0.23
85 0.23
86 0.23
87 0.19
88 0.18
89 0.15
90 0.13
91 0.14
92 0.14
93 0.13
94 0.13
95 0.15
96 0.14
97 0.16
98 0.16
99 0.14
100 0.15
101 0.16
102 0.18
103 0.15
104 0.14
105 0.13
106 0.13
107 0.12
108 0.12
109 0.12
110 0.13
111 0.13
112 0.13
113 0.13
114 0.14
115 0.14
116 0.15
117 0.14
118 0.1
119 0.12
120 0.13
121 0.13
122 0.13
123 0.15
124 0.14
125 0.15
126 0.14
127 0.13
128 0.11
129 0.11
130 0.1
131 0.07
132 0.07
133 0.07
134 0.07
135 0.07
136 0.1
137 0.11
138 0.11
139 0.14
140 0.16
141 0.14
142 0.15
143 0.14
144 0.14
145 0.12
146 0.12
147 0.1
148 0.09
149 0.09
150 0.1
151 0.1
152 0.1
153 0.1
154 0.11
155 0.17
156 0.23
157 0.28
158 0.28
159 0.3
160 0.32
161 0.36
162 0.36
163 0.32
164 0.27
165 0.22
166 0.21
167 0.2
168 0.17
169 0.12
170 0.1
171 0.09
172 0.07
173 0.07
174 0.07
175 0.06
176 0.08
177 0.08
178 0.08
179 0.08
180 0.08
181 0.09
182 0.1
183 0.09
184 0.07
185 0.09
186 0.09
187 0.09
188 0.09
189 0.08
190 0.09
191 0.09
192 0.09
193 0.08
194 0.1
195 0.1
196 0.13
197 0.19
198 0.19
199 0.22
200 0.24
201 0.29
202 0.34
203 0.41
204 0.43
205 0.45
206 0.45
207 0.49
208 0.52
209 0.47
210 0.43
211 0.36
212 0.32
213 0.25
214 0.23
215 0.17
216 0.12
217 0.12