Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W3X7P3

Protein Details
Accession W3X7P3    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
233-267VDEVGSRRSSTKRKKEPRRDSPERPVRRSKRGKETBasic
NLS Segment(s)
PositionSequence
237-267GSRRSSTKRKKEPRRDSPERPVRRSKRGKET
Subcellular Location(s) nucl 20.5, mito_nucl 11, cyto 6
Family & Domain DBs
KEGG pfy:PFICI_06193  -  
Amino Acid Sequences MTKNQPRPEDISGDDFQDLLNKYPALIESISTTKAGQKTLSELDEFRYEKAPEQFRSQSPKRTMTHDDVKTLVDWKLRHGKFRPTLMKLVSSNDGGTVADTIQQAMGAYWDEGQDASAALAAICKLKGIGPATASLLLSVHDPERVIFFSDEAFWWLCCSGQKAPIKYNPKEYAELNQAAQALVQRLNVSATAVEKVAYVIMKDEALPLTAVEKPKVTKKAPSGKTPAESKTVDEVGSRRSSTKRKKEPRRDSPERPVRRSKRGKET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.28
3 0.23
4 0.24
5 0.22
6 0.18
7 0.2
8 0.18
9 0.17
10 0.19
11 0.2
12 0.17
13 0.16
14 0.14
15 0.14
16 0.17
17 0.18
18 0.17
19 0.17
20 0.19
21 0.21
22 0.22
23 0.2
24 0.19
25 0.23
26 0.27
27 0.28
28 0.25
29 0.23
30 0.25
31 0.3
32 0.29
33 0.26
34 0.27
35 0.25
36 0.29
37 0.36
38 0.4
39 0.35
40 0.42
41 0.46
42 0.46
43 0.55
44 0.55
45 0.56
46 0.56
47 0.61
48 0.56
49 0.57
50 0.58
51 0.56
52 0.61
53 0.54
54 0.5
55 0.43
56 0.42
57 0.36
58 0.32
59 0.26
60 0.21
61 0.19
62 0.23
63 0.32
64 0.32
65 0.39
66 0.4
67 0.48
68 0.49
69 0.59
70 0.6
71 0.54
72 0.58
73 0.52
74 0.53
75 0.44
76 0.41
77 0.34
78 0.27
79 0.23
80 0.18
81 0.17
82 0.11
83 0.11
84 0.08
85 0.06
86 0.08
87 0.07
88 0.07
89 0.07
90 0.07
91 0.07
92 0.06
93 0.06
94 0.04
95 0.04
96 0.05
97 0.05
98 0.05
99 0.05
100 0.05
101 0.05
102 0.04
103 0.04
104 0.04
105 0.04
106 0.03
107 0.04
108 0.04
109 0.04
110 0.04
111 0.04
112 0.04
113 0.05
114 0.08
115 0.09
116 0.1
117 0.1
118 0.11
119 0.12
120 0.12
121 0.11
122 0.08
123 0.07
124 0.06
125 0.06
126 0.06
127 0.06
128 0.05
129 0.06
130 0.06
131 0.07
132 0.07
133 0.09
134 0.08
135 0.08
136 0.08
137 0.09
138 0.09
139 0.09
140 0.09
141 0.07
142 0.07
143 0.07
144 0.07
145 0.08
146 0.11
147 0.11
148 0.18
149 0.23
150 0.25
151 0.3
152 0.37
153 0.45
154 0.44
155 0.51
156 0.49
157 0.48
158 0.48
159 0.44
160 0.41
161 0.39
162 0.38
163 0.29
164 0.25
165 0.22
166 0.2
167 0.19
168 0.15
169 0.11
170 0.1
171 0.11
172 0.09
173 0.09
174 0.1
175 0.1
176 0.09
177 0.08
178 0.08
179 0.08
180 0.08
181 0.08
182 0.07
183 0.07
184 0.08
185 0.08
186 0.07
187 0.07
188 0.08
189 0.08
190 0.08
191 0.09
192 0.08
193 0.09
194 0.09
195 0.07
196 0.09
197 0.12
198 0.14
199 0.13
200 0.16
201 0.18
202 0.26
203 0.34
204 0.34
205 0.39
206 0.47
207 0.56
208 0.6
209 0.65
210 0.65
211 0.64
212 0.67
213 0.64
214 0.58
215 0.53
216 0.48
217 0.43
218 0.4
219 0.36
220 0.31
221 0.28
222 0.26
223 0.26
224 0.3
225 0.28
226 0.26
227 0.32
228 0.43
229 0.51
230 0.61
231 0.66
232 0.73
233 0.83
234 0.91
235 0.94
236 0.95
237 0.95
238 0.94
239 0.92
240 0.93
241 0.92
242 0.91
243 0.87
244 0.87
245 0.86
246 0.87
247 0.88