Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W3WPE3

Protein Details
Accession W3WPE3   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
61-111REQARREQERREQKRQERKEQERRERKEQERQERKEQERRERKEQERRERKBasic
NLS Segment(s)
PositionSequence
54-111ERREQERREQARREQERREQKRQERKEQERRERKEQERQERKEQERRERKEQERRERK
Subcellular Location(s) nucl 22.5, cyto_nucl 14, cyto 2.5
Family & Domain DBs
KEGG pfy:PFICI_13506  -  
Amino Acid Sequences MSYYHRHESRRSAAAESYAPRASTYHHASRRTRDDSSDSDTSEEDTRQERKEQERREQERREQARREQERREQKRQERKEQERRERKEQERQERKEQERRERKEQERRERK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.42
3 0.36
4 0.33
5 0.28
6 0.26
7 0.23
8 0.22
9 0.22
10 0.25
11 0.3
12 0.34
13 0.39
14 0.46
15 0.5
16 0.57
17 0.62
18 0.61
19 0.55
20 0.49
21 0.48
22 0.44
23 0.47
24 0.41
25 0.33
26 0.28
27 0.27
28 0.26
29 0.22
30 0.18
31 0.13
32 0.14
33 0.17
34 0.17
35 0.21
36 0.23
37 0.31
38 0.4
39 0.44
40 0.5
41 0.58
42 0.64
43 0.69
44 0.7
45 0.68
46 0.7
47 0.71
48 0.68
49 0.63
50 0.62
51 0.64
52 0.68
53 0.67
54 0.64
55 0.66
56 0.7
57 0.73
58 0.77
59 0.76
60 0.77
61 0.82
62 0.84
63 0.86
64 0.85
65 0.88
66 0.89
67 0.9
68 0.91
69 0.91
70 0.9
71 0.89
72 0.88
73 0.85
74 0.84
75 0.84
76 0.84
77 0.84
78 0.84
79 0.84
80 0.84
81 0.85
82 0.84
83 0.83
84 0.83
85 0.83
86 0.84
87 0.83
88 0.83
89 0.85
90 0.86
91 0.87