Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C1GX61

Protein Details
Accession C1GX61    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
12-32GSLQLRKTRRAAQIRNKRGIPHydrophilic
NLS Segment(s)
PositionSequence
17-42RKTRRAAQIRNKRGIPSTIWQRKAKR
Subcellular Location(s) mito 14, nucl 10, cyto 2
Family & Domain DBs
KEGG pbl:PAAG_03435  -  
Amino Acid Sequences MVVEVVLKKPMGSLQLRKTRRAAQIRNKRGIPSTIWQRKAKRLKVQAAAVLPKCERHNYDGCCGSACVLKTDDDDTDNLRKNQLQHLKTLQSLLGTVQITIGTLKPDNAAALWEKISTGYTVLLAEEFYYLVAQYKELSTDTEDFHDIFLLGNRDNQQVFVKTKINKFDATGQGLVSNIDIDDLTKQLTNCTNKTQGCGMSEHLVSECHHPYEQYDVQFIYHDVCNLQTPYAYEGYVLAPAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.51
3 0.55
4 0.58
5 0.62
6 0.63
7 0.67
8 0.69
9 0.69
10 0.7
11 0.78
12 0.83
13 0.86
14 0.8
15 0.73
16 0.66
17 0.6
18 0.53
19 0.51
20 0.53
21 0.54
22 0.58
23 0.62
24 0.64
25 0.7
26 0.76
27 0.75
28 0.74
29 0.75
30 0.76
31 0.76
32 0.74
33 0.69
34 0.64
35 0.62
36 0.54
37 0.48
38 0.4
39 0.37
40 0.35
41 0.35
42 0.33
43 0.31
44 0.37
45 0.37
46 0.43
47 0.43
48 0.4
49 0.37
50 0.34
51 0.29
52 0.24
53 0.21
54 0.16
55 0.14
56 0.14
57 0.14
58 0.16
59 0.16
60 0.14
61 0.14
62 0.16
63 0.21
64 0.25
65 0.24
66 0.24
67 0.25
68 0.26
69 0.34
70 0.4
71 0.35
72 0.35
73 0.39
74 0.4
75 0.38
76 0.37
77 0.28
78 0.19
79 0.19
80 0.14
81 0.13
82 0.11
83 0.1
84 0.09
85 0.08
86 0.08
87 0.08
88 0.08
89 0.06
90 0.06
91 0.07
92 0.07
93 0.07
94 0.07
95 0.06
96 0.07
97 0.07
98 0.08
99 0.08
100 0.07
101 0.07
102 0.07
103 0.08
104 0.06
105 0.06
106 0.05
107 0.05
108 0.05
109 0.05
110 0.05
111 0.04
112 0.04
113 0.04
114 0.04
115 0.03
116 0.03
117 0.03
118 0.05
119 0.05
120 0.05
121 0.05
122 0.05
123 0.06
124 0.07
125 0.08
126 0.09
127 0.1
128 0.11
129 0.12
130 0.13
131 0.12
132 0.12
133 0.11
134 0.09
135 0.07
136 0.09
137 0.09
138 0.08
139 0.11
140 0.13
141 0.14
142 0.14
143 0.16
144 0.16
145 0.18
146 0.2
147 0.21
148 0.25
149 0.28
150 0.33
151 0.37
152 0.38
153 0.35
154 0.35
155 0.39
156 0.38
157 0.37
158 0.33
159 0.27
160 0.25
161 0.24
162 0.22
163 0.14
164 0.09
165 0.05
166 0.05
167 0.05
168 0.05
169 0.06
170 0.06
171 0.07
172 0.09
173 0.09
174 0.12
175 0.19
176 0.24
177 0.26
178 0.31
179 0.38
180 0.37
181 0.4
182 0.41
183 0.36
184 0.33
185 0.32
186 0.3
187 0.26
188 0.25
189 0.23
190 0.19
191 0.18
192 0.18
193 0.21
194 0.21
195 0.19
196 0.2
197 0.19
198 0.2
199 0.27
200 0.3
201 0.27
202 0.26
203 0.24
204 0.24
205 0.25
206 0.24
207 0.19
208 0.15
209 0.15
210 0.13
211 0.14
212 0.17
213 0.17
214 0.18
215 0.15
216 0.16
217 0.19
218 0.2
219 0.18
220 0.14
221 0.14
222 0.15