Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C1GTE7

Protein Details
Accession C1GTE7    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
32-52TVTLKRVNRVKRPLNNVTQHTHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 12, mito 8, cyto 4, nucl 3
Family & Domain DBs
KEGG pbl:PAAG_01792  -  
Amino Acid Sequences MPTILLPASAAAFAPRSSPNVVLNSRVEPWLTVTLKRVNRVKRPLNNVTQHTRCLTETLSSSNAIWTLCSIMLPKAPESELRQDENLLVEALFNYQLVHMEAYVVHVDMVSQNEVAFKLTPETIESLVEHHKDIYSVDTAAKTWNWSEKEIQLKKLQEEFVQAANRFVYRASATALEGMEEDGAGELLCGRSDEAKAAILGLFVPLLPPPPRIVDAVRPTPILPSSTGPDNWWHSPIQQPHPEPVDSWKVVPSSPSTTSSDSNQNLWAASIALNEIQASSPALSNSHPYSTTAYSETQYYSTPATTASITQFLLPSMLAQQQCSTAANMGGFGWGERYQDFALPYGTTM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.16
4 0.18
5 0.21
6 0.24
7 0.3
8 0.32
9 0.34
10 0.35
11 0.35
12 0.34
13 0.33
14 0.29
15 0.22
16 0.24
17 0.28
18 0.27
19 0.26
20 0.29
21 0.36
22 0.4
23 0.47
24 0.51
25 0.51
26 0.59
27 0.68
28 0.73
29 0.73
30 0.78
31 0.8
32 0.82
33 0.81
34 0.78
35 0.77
36 0.7
37 0.65
38 0.58
39 0.51
40 0.42
41 0.36
42 0.3
43 0.24
44 0.22
45 0.22
46 0.22
47 0.2
48 0.2
49 0.18
50 0.18
51 0.15
52 0.13
53 0.1
54 0.1
55 0.09
56 0.1
57 0.1
58 0.1
59 0.13
60 0.15
61 0.15
62 0.15
63 0.16
64 0.19
65 0.23
66 0.3
67 0.32
68 0.33
69 0.32
70 0.31
71 0.31
72 0.28
73 0.24
74 0.16
75 0.11
76 0.09
77 0.08
78 0.08
79 0.08
80 0.06
81 0.06
82 0.05
83 0.06
84 0.07
85 0.07
86 0.06
87 0.07
88 0.06
89 0.08
90 0.08
91 0.07
92 0.06
93 0.06
94 0.06
95 0.07
96 0.08
97 0.07
98 0.07
99 0.07
100 0.08
101 0.08
102 0.09
103 0.09
104 0.07
105 0.08
106 0.09
107 0.09
108 0.09
109 0.11
110 0.1
111 0.11
112 0.11
113 0.11
114 0.14
115 0.15
116 0.14
117 0.13
118 0.12
119 0.12
120 0.12
121 0.12
122 0.09
123 0.09
124 0.1
125 0.1
126 0.1
127 0.11
128 0.11
129 0.1
130 0.1
131 0.15
132 0.16
133 0.18
134 0.2
135 0.23
136 0.33
137 0.35
138 0.37
139 0.36
140 0.37
141 0.37
142 0.39
143 0.35
144 0.26
145 0.26
146 0.24
147 0.23
148 0.24
149 0.22
150 0.19
151 0.18
152 0.17
153 0.14
154 0.13
155 0.1
156 0.07
157 0.08
158 0.08
159 0.08
160 0.08
161 0.1
162 0.09
163 0.08
164 0.07
165 0.07
166 0.06
167 0.05
168 0.04
169 0.03
170 0.03
171 0.03
172 0.02
173 0.02
174 0.03
175 0.03
176 0.03
177 0.03
178 0.05
179 0.05
180 0.06
181 0.06
182 0.07
183 0.07
184 0.07
185 0.07
186 0.06
187 0.05
188 0.05
189 0.04
190 0.03
191 0.04
192 0.03
193 0.06
194 0.07
195 0.08
196 0.09
197 0.11
198 0.13
199 0.14
200 0.16
201 0.21
202 0.25
203 0.29
204 0.29
205 0.28
206 0.26
207 0.26
208 0.25
209 0.19
210 0.15
211 0.13
212 0.14
213 0.16
214 0.17
215 0.16
216 0.19
217 0.23
218 0.23
219 0.23
220 0.21
221 0.2
222 0.26
223 0.31
224 0.35
225 0.38
226 0.38
227 0.41
228 0.44
229 0.43
230 0.37
231 0.35
232 0.35
233 0.28
234 0.27
235 0.25
236 0.23
237 0.22
238 0.23
239 0.22
240 0.19
241 0.21
242 0.24
243 0.25
244 0.27
245 0.29
246 0.31
247 0.35
248 0.32
249 0.3
250 0.29
251 0.26
252 0.23
253 0.22
254 0.19
255 0.11
256 0.1
257 0.09
258 0.07
259 0.07
260 0.07
261 0.07
262 0.07
263 0.06
264 0.06
265 0.07
266 0.07
267 0.08
268 0.08
269 0.1
270 0.1
271 0.14
272 0.16
273 0.18
274 0.17
275 0.18
276 0.22
277 0.23
278 0.25
279 0.23
280 0.23
281 0.21
282 0.22
283 0.22
284 0.19
285 0.17
286 0.17
287 0.16
288 0.14
289 0.13
290 0.12
291 0.13
292 0.12
293 0.14
294 0.14
295 0.15
296 0.15
297 0.16
298 0.16
299 0.14
300 0.14
301 0.12
302 0.1
303 0.11
304 0.16
305 0.16
306 0.16
307 0.17
308 0.18
309 0.2
310 0.2
311 0.19
312 0.15
313 0.16
314 0.15
315 0.15
316 0.13
317 0.13
318 0.11
319 0.1
320 0.12
321 0.11
322 0.13
323 0.12
324 0.16
325 0.16
326 0.19
327 0.2
328 0.18
329 0.19