Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W3X408

Protein Details
Accession W3X408   
Localization Confidence Medium
Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
14-40ALKLKGGKVSKSKKKKKDKAAGLEHALBasic
NLS Segment(s)
PositionSequence
16-34KLKGGKVSKSKKKKKDKAA
53-60KPAGKKKS
Subcellular Location(s) nucl 19, cyto_nucl 12.833, mito_nucl 12.499, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
KEGG pfy:PFICI_07435  -  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MPSDDYTAFSGGGALKLKGGKVSKSKKKKKDKAAGLEHALSTGEPADSKELEKPAGKKKSPRDDERPEEEDEHDEPIEYKTEAQKRHEEYKRKKMLELAQSSSSRPELLKTHKERVEELNTYLSKLSEHHDMPKIGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.14
3 0.15
4 0.16
5 0.2
6 0.22
7 0.25
8 0.34
9 0.44
10 0.53
11 0.63
12 0.73
13 0.78
14 0.87
15 0.9
16 0.91
17 0.91
18 0.91
19 0.9
20 0.89
21 0.85
22 0.78
23 0.7
24 0.58
25 0.48
26 0.38
27 0.27
28 0.17
29 0.11
30 0.07
31 0.05
32 0.06
33 0.08
34 0.08
35 0.1
36 0.12
37 0.13
38 0.15
39 0.18
40 0.22
41 0.29
42 0.38
43 0.39
44 0.44
45 0.52
46 0.61
47 0.66
48 0.68
49 0.68
50 0.68
51 0.72
52 0.71
53 0.65
54 0.56
55 0.49
56 0.42
57 0.36
58 0.28
59 0.23
60 0.16
61 0.13
62 0.12
63 0.11
64 0.11
65 0.09
66 0.09
67 0.14
68 0.19
69 0.23
70 0.26
71 0.33
72 0.37
73 0.47
74 0.53
75 0.58
76 0.62
77 0.69
78 0.75
79 0.7
80 0.66
81 0.62
82 0.62
83 0.61
84 0.57
85 0.51
86 0.47
87 0.47
88 0.46
89 0.41
90 0.34
91 0.26
92 0.2
93 0.19
94 0.2
95 0.27
96 0.37
97 0.41
98 0.5
99 0.52
100 0.54
101 0.53
102 0.54
103 0.54
104 0.46
105 0.42
106 0.41
107 0.38
108 0.37
109 0.35
110 0.28
111 0.21
112 0.19
113 0.2
114 0.2
115 0.22
116 0.27
117 0.33
118 0.34