Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W3WYM3

Protein Details
Accession W3WYM3    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MAPAATGAKKQKKKWSKGKVKDKAQHAVLHydrophilic
NLS Segment(s)
PositionSequence
8-23AKKQKKKWSKGKVKDK
Subcellular Location(s) nucl 20, mito_nucl 12.333, cyto_nucl 11.833, mito 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG pfy:PFICI_08803  -  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAATGAKKQKKKWSKGKVKDKAQHAVLLDKQTSEKLYKDVQSYRLVTVSTLVDRLKINGSLARKCLKDLEEKGQIKSVVTHSKMKIYTRAVGASD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.85
3 0.86
4 0.89
5 0.93
6 0.92
7 0.92
8 0.89
9 0.85
10 0.82
11 0.72
12 0.65
13 0.55
14 0.5
15 0.42
16 0.38
17 0.32
18 0.25
19 0.23
20 0.2
21 0.21
22 0.18
23 0.15
24 0.15
25 0.18
26 0.2
27 0.23
28 0.25
29 0.27
30 0.29
31 0.3
32 0.28
33 0.25
34 0.22
35 0.18
36 0.16
37 0.14
38 0.09
39 0.1
40 0.09
41 0.1
42 0.1
43 0.11
44 0.11
45 0.11
46 0.11
47 0.13
48 0.17
49 0.18
50 0.21
51 0.25
52 0.24
53 0.24
54 0.27
55 0.26
56 0.31
57 0.33
58 0.38
59 0.43
60 0.45
61 0.45
62 0.46
63 0.44
64 0.36
65 0.34
66 0.33
67 0.32
68 0.33
69 0.39
70 0.36
71 0.43
72 0.46
73 0.46
74 0.47
75 0.43
76 0.45
77 0.41