Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W3WM15

Protein Details
Accession W3WM15   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
204-226GTGPSLAGKRRKRNPWGVPQDLFHydrophilic
NLS Segment(s)
PositionSequence
213-215RRK
Subcellular Location(s) cyto 13, cyto_nucl 9.833, cyto_mito 8.999, extr 4, nucl 3.5, mito 3.5
Family & Domain DBs
KEGG pfy:PFICI_13392  -  
Amino Acid Sequences MSPTKLIIVCCHGIWAGGPGRGLDESEWLIAPFQVGETPTFVEHIKAGLRALKQDKEAVLMFSGGPTRNETKISEAESYHNLAIANSYFGILSDPSETSRIVSESRALDSYYNVLFCLVKFWQECRGHTAADDDKAWWPERITIVSHAFKRERLVDCHCGAIGYPLDRVDFIGVDPPGMLDGSNAAAIQGVMKAVAEWKEDPHGTGPSLAGKRRKRNPWGVPQDLFLSDESRGRSGVKTILVDGVEVLDPKVEQPWSLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.2
3 0.17
4 0.17
5 0.17
6 0.16
7 0.18
8 0.18
9 0.19
10 0.14
11 0.13
12 0.13
13 0.14
14 0.14
15 0.12
16 0.12
17 0.11
18 0.11
19 0.08
20 0.07
21 0.08
22 0.08
23 0.09
24 0.1
25 0.11
26 0.11
27 0.13
28 0.12
29 0.12
30 0.11
31 0.12
32 0.12
33 0.12
34 0.13
35 0.16
36 0.17
37 0.23
38 0.28
39 0.29
40 0.3
41 0.32
42 0.31
43 0.3
44 0.3
45 0.24
46 0.19
47 0.16
48 0.14
49 0.12
50 0.14
51 0.12
52 0.12
53 0.15
54 0.17
55 0.18
56 0.21
57 0.21
58 0.22
59 0.24
60 0.26
61 0.25
62 0.23
63 0.24
64 0.24
65 0.26
66 0.21
67 0.19
68 0.16
69 0.13
70 0.14
71 0.11
72 0.1
73 0.07
74 0.07
75 0.06
76 0.06
77 0.07
78 0.06
79 0.06
80 0.07
81 0.07
82 0.08
83 0.1
84 0.09
85 0.09
86 0.1
87 0.1
88 0.1
89 0.1
90 0.12
91 0.12
92 0.14
93 0.14
94 0.13
95 0.12
96 0.12
97 0.14
98 0.11
99 0.1
100 0.08
101 0.08
102 0.08
103 0.07
104 0.1
105 0.08
106 0.1
107 0.11
108 0.12
109 0.21
110 0.23
111 0.24
112 0.26
113 0.28
114 0.24
115 0.24
116 0.27
117 0.19
118 0.18
119 0.18
120 0.13
121 0.14
122 0.16
123 0.17
124 0.14
125 0.12
126 0.13
127 0.14
128 0.14
129 0.14
130 0.16
131 0.19
132 0.23
133 0.24
134 0.26
135 0.25
136 0.25
137 0.26
138 0.28
139 0.27
140 0.27
141 0.32
142 0.33
143 0.33
144 0.33
145 0.3
146 0.24
147 0.21
148 0.19
149 0.14
150 0.1
151 0.1
152 0.09
153 0.1
154 0.1
155 0.1
156 0.08
157 0.07
158 0.06
159 0.1
160 0.09
161 0.09
162 0.09
163 0.08
164 0.08
165 0.08
166 0.08
167 0.03
168 0.04
169 0.05
170 0.05
171 0.05
172 0.05
173 0.05
174 0.05
175 0.05
176 0.05
177 0.04
178 0.04
179 0.04
180 0.04
181 0.06
182 0.08
183 0.1
184 0.11
185 0.12
186 0.17
187 0.17
188 0.19
189 0.19
190 0.2
191 0.18
192 0.18
193 0.17
194 0.2
195 0.25
196 0.29
197 0.35
198 0.42
199 0.52
200 0.6
201 0.69
202 0.71
203 0.78
204 0.82
205 0.84
206 0.85
207 0.83
208 0.75
209 0.67
210 0.6
211 0.51
212 0.42
213 0.32
214 0.24
215 0.17
216 0.19
217 0.19
218 0.17
219 0.17
220 0.18
221 0.18
222 0.19
223 0.22
224 0.23
225 0.22
226 0.22
227 0.25
228 0.23
229 0.22
230 0.19
231 0.16
232 0.13
233 0.12
234 0.11
235 0.09
236 0.09
237 0.09
238 0.13
239 0.12