Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W3WP62

Protein Details
Accession W3WP62   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
1-49MVSAKKHVPIVKKRTKSFRRHQSDRFMRVDPSWRKPKGIDNRVRRRFKGHydrophilic
NLS Segment(s)
PositionSequence
9-48PIVKKRTKSFRRHQSDRFMRVDPSWRKPKGIDNRVRRRFK
Subcellular Location(s) mito 15, mito_nucl 12.833, nucl 8.5, cyto_nucl 6.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG pfy:PFICI_12634  -  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVSAKKHVPIVKKRTKSFRRHQSDRFMRVDPSWRKPKGIDNRVRRRFKGNQVMPSIGFGSNKKTRHMMPSGHKAFLVSNTKDVELLLMHNRTYAAEIAHNVSSRKRVDIISRAKQLGVKVTNPKAKVTTEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.85
3 0.86
4 0.86
5 0.86
6 0.86
7 0.86
8 0.86
9 0.86
10 0.86
11 0.83
12 0.76
13 0.67
14 0.59
15 0.53
16 0.55
17 0.51
18 0.5
19 0.53
20 0.5
21 0.5
22 0.5
23 0.57
24 0.58
25 0.61
26 0.62
27 0.63
28 0.73
29 0.8
30 0.84
31 0.77
32 0.74
33 0.71
34 0.71
35 0.71
36 0.66
37 0.63
38 0.6
39 0.6
40 0.52
41 0.45
42 0.37
43 0.26
44 0.21
45 0.14
46 0.17
47 0.22
48 0.23
49 0.23
50 0.24
51 0.25
52 0.29
53 0.32
54 0.32
55 0.33
56 0.42
57 0.43
58 0.41
59 0.39
60 0.35
61 0.31
62 0.31
63 0.31
64 0.21
65 0.22
66 0.22
67 0.23
68 0.22
69 0.21
70 0.16
71 0.09
72 0.11
73 0.12
74 0.12
75 0.12
76 0.12
77 0.13
78 0.12
79 0.13
80 0.12
81 0.09
82 0.09
83 0.11
84 0.13
85 0.15
86 0.16
87 0.16
88 0.17
89 0.22
90 0.22
91 0.23
92 0.22
93 0.23
94 0.29
95 0.37
96 0.45
97 0.48
98 0.53
99 0.51
100 0.5
101 0.5
102 0.45
103 0.45
104 0.39
105 0.37
106 0.4
107 0.47
108 0.53
109 0.52
110 0.54
111 0.48