Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W3X2J2

Protein Details
Accession W3X2J2    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
194-220DDADAKKKRRPGKKRRIVLRTRAKAEKBasic
231-265ESKEEHLKAKKQRLNREKKLKRRAKDKEKKAAAGABasic
NLS Segment(s)
PositionSequence
199-261KKKRRPGKKRRIVLRTRAKAEKEKAEAARKFLESKEEHLKAKKQRLNREKKLKRRAKDKEKKA
Subcellular Location(s) nucl 18.5, cyto_nucl 13.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018555  DUF2011  
KEGG pfy:PFICI_09470  -  
Pfam View protein in Pfam  
PF09428  DUF2011  
Amino Acid Sequences MFEVPDSKRVRRDELFNDVGNDGDAPSDAEVSLDEDAEKELRRRLNAQLSGLLDFDITAPTEPVKGSSGQVIGEAAAAEDGEEEPDELAFEFRLFRDEAPSHTVVIQQNEDKPGALGAGGFVMPRRPDAYYIAEAPDAATLEKLRYSAVSSDHLLADAGRRRWGLERPWRVLRISVSGKPLTDGSSSAVTATADDADAKKKRRPGKKRRIVLRTRAKAEKEKAEAARKFLESKEEHLKAKKQRLNREKKLKRRAKDKEKKAAAGATGDSGSVAGQGADVEMADDISDGGSAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.59
3 0.53
4 0.51
5 0.44
6 0.38
7 0.3
8 0.24
9 0.15
10 0.1
11 0.09
12 0.07
13 0.07
14 0.07
15 0.07
16 0.07
17 0.07
18 0.08
19 0.09
20 0.08
21 0.07
22 0.07
23 0.09
24 0.11
25 0.13
26 0.14
27 0.19
28 0.23
29 0.26
30 0.29
31 0.36
32 0.43
33 0.45
34 0.45
35 0.44
36 0.42
37 0.4
38 0.36
39 0.28
40 0.18
41 0.14
42 0.12
43 0.08
44 0.07
45 0.06
46 0.07
47 0.07
48 0.08
49 0.08
50 0.09
51 0.1
52 0.11
53 0.11
54 0.13
55 0.14
56 0.13
57 0.13
58 0.12
59 0.1
60 0.09
61 0.08
62 0.05
63 0.04
64 0.04
65 0.03
66 0.04
67 0.04
68 0.04
69 0.04
70 0.04
71 0.04
72 0.05
73 0.05
74 0.05
75 0.05
76 0.05
77 0.05
78 0.06
79 0.06
80 0.08
81 0.09
82 0.09
83 0.14
84 0.15
85 0.17
86 0.22
87 0.23
88 0.21
89 0.21
90 0.25
91 0.21
92 0.22
93 0.22
94 0.19
95 0.2
96 0.21
97 0.21
98 0.17
99 0.15
100 0.12
101 0.1
102 0.08
103 0.05
104 0.04
105 0.04
106 0.04
107 0.04
108 0.04
109 0.06
110 0.06
111 0.07
112 0.08
113 0.08
114 0.1
115 0.13
116 0.17
117 0.17
118 0.18
119 0.18
120 0.16
121 0.15
122 0.14
123 0.11
124 0.08
125 0.06
126 0.05
127 0.05
128 0.05
129 0.06
130 0.06
131 0.05
132 0.05
133 0.06
134 0.08
135 0.09
136 0.11
137 0.12
138 0.12
139 0.12
140 0.12
141 0.11
142 0.09
143 0.11
144 0.14
145 0.14
146 0.14
147 0.15
148 0.16
149 0.18
150 0.23
151 0.28
152 0.33
153 0.4
154 0.44
155 0.48
156 0.49
157 0.47
158 0.45
159 0.37
160 0.34
161 0.31
162 0.29
163 0.29
164 0.28
165 0.27
166 0.26
167 0.25
168 0.2
169 0.16
170 0.13
171 0.11
172 0.12
173 0.11
174 0.11
175 0.11
176 0.09
177 0.08
178 0.08
179 0.06
180 0.05
181 0.06
182 0.07
183 0.13
184 0.18
185 0.21
186 0.25
187 0.32
188 0.41
189 0.51
190 0.61
191 0.66
192 0.73
193 0.8
194 0.86
195 0.89
196 0.91
197 0.89
198 0.88
199 0.88
200 0.85
201 0.81
202 0.78
203 0.73
204 0.71
205 0.68
206 0.66
207 0.59
208 0.58
209 0.57
210 0.6
211 0.57
212 0.53
213 0.51
214 0.45
215 0.42
216 0.36
217 0.38
218 0.3
219 0.34
220 0.4
221 0.4
222 0.43
223 0.46
224 0.54
225 0.55
226 0.63
227 0.63
228 0.62
229 0.69
230 0.75
231 0.81
232 0.83
233 0.85
234 0.85
235 0.91
236 0.93
237 0.92
238 0.9
239 0.9
240 0.9
241 0.9
242 0.91
243 0.91
244 0.91
245 0.89
246 0.84
247 0.77
248 0.7
249 0.6
250 0.52
251 0.42
252 0.34
253 0.26
254 0.21
255 0.17
256 0.13
257 0.1
258 0.08
259 0.07
260 0.04
261 0.04
262 0.04
263 0.05
264 0.05
265 0.04
266 0.04
267 0.04
268 0.04
269 0.04
270 0.04
271 0.04
272 0.04