Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W3WMX8

Protein Details
Accession W3WMX8    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MPISKKDRRAREQKAGDKAGBasic
NLS Segment(s)
PositionSequence
6-20KDRRAREQKAGDKAG
Subcellular Location(s) nucl 17, mito_nucl 12.333, cyto_nucl 10.833, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR026939  ZNF706/At2g23090_sf  
KEGG pfy:PFICI_14388  -  
Amino Acid Sequences MPISKKDRRAREQKAGDKAGTRAAVKANGLPVKAPKPTSICQNCRKEIVNTNKIQLEVHAGTHDPKLWPKEKCWPNDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.78
3 0.7
4 0.62
5 0.54
6 0.48
7 0.41
8 0.33
9 0.25
10 0.23
11 0.23
12 0.2
13 0.21
14 0.21
15 0.2
16 0.19
17 0.18
18 0.2
19 0.21
20 0.23
21 0.22
22 0.2
23 0.23
24 0.24
25 0.33
26 0.38
27 0.42
28 0.49
29 0.54
30 0.53
31 0.51
32 0.52
33 0.46
34 0.47
35 0.5
36 0.49
37 0.45
38 0.46
39 0.44
40 0.43
41 0.39
42 0.3
43 0.27
44 0.19
45 0.18
46 0.16
47 0.15
48 0.17
49 0.18
50 0.2
51 0.16
52 0.2
53 0.27
54 0.33
55 0.36
56 0.39
57 0.49
58 0.54