Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W3X2W4

Protein Details
Accession W3X2W4    Localization Confidence High Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
77-98REQWRLIRKIRKKLDRYSERNHBasic
NLS Segment(s)
PositionSequence
85-89KIRKK
Subcellular Location(s) nucl 19, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR046529  DUF6594  
KEGG pfy:PFICI_09344  -  
Pfam View protein in Pfam  
PF20237  DUF6594  
Amino Acid Sequences MEGYAKVAHLMSKYDEFAVLRRFERLNIQSLLYSQAEIVHLEDSLARLVARDADDPEKEFHAKDWWSLAHGEGETGREQWRLIRKIRKKLDRYSERNHEWRVRRLLLIAMRRRSSPQTSRNIQLGKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.19
4 0.22
5 0.25
6 0.25
7 0.22
8 0.25
9 0.25
10 0.25
11 0.33
12 0.31
13 0.31
14 0.29
15 0.29
16 0.26
17 0.26
18 0.29
19 0.2
20 0.18
21 0.12
22 0.12
23 0.11
24 0.11
25 0.11
26 0.07
27 0.07
28 0.07
29 0.07
30 0.07
31 0.06
32 0.06
33 0.05
34 0.05
35 0.05
36 0.07
37 0.08
38 0.08
39 0.1
40 0.13
41 0.14
42 0.15
43 0.16
44 0.16
45 0.15
46 0.14
47 0.13
48 0.15
49 0.14
50 0.13
51 0.14
52 0.12
53 0.13
54 0.13
55 0.13
56 0.1
57 0.09
58 0.09
59 0.08
60 0.09
61 0.09
62 0.09
63 0.1
64 0.09
65 0.09
66 0.13
67 0.21
68 0.25
69 0.32
70 0.41
71 0.48
72 0.58
73 0.68
74 0.74
75 0.72
76 0.77
77 0.81
78 0.81
79 0.8
80 0.79
81 0.79
82 0.77
83 0.76
84 0.73
85 0.71
86 0.67
87 0.68
88 0.66
89 0.59
90 0.53
91 0.47
92 0.47
93 0.45
94 0.48
95 0.48
96 0.48
97 0.47
98 0.48
99 0.51
100 0.51
101 0.53
102 0.53
103 0.53
104 0.56
105 0.6
106 0.64
107 0.67