Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W3X2N7

Protein Details
Accession W3X2N7   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
165-191SSDNIEPRKARRKRKMETKIQDHCTPGHydrophilic
NLS Segment(s)
PositionSequence
172-179RKARRKRK
Subcellular Location(s) nucl 19, mito_nucl 12.833, cyto_nucl 11.333, mito 5.5
Family & Domain DBs
KEGG pfy:PFICI_09274  -  
Amino Acid Sequences MAYLLGRYKQPLYGLMSTYQSAQAADNAQEHKQEAPAGMSTQPGSPHGSHDRADKDSPNQIHRKQTSSNGPVSAKGKHKPMQERPADTVQQETFTFSPSLENHTRRTSGNKVMGLERKPDETSDDTYQPRKPARRLSRKDVMEMNGGPQETSDSSVDNGGFVSESSDNIEPRKARRKRKMETKIQDHCTPGTSEQESLPEKRPSKFRKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.29
3 0.3
4 0.28
5 0.28
6 0.25
7 0.19
8 0.16
9 0.14
10 0.14
11 0.14
12 0.15
13 0.18
14 0.19
15 0.2
16 0.21
17 0.21
18 0.2
19 0.2
20 0.19
21 0.16
22 0.15
23 0.15
24 0.15
25 0.15
26 0.15
27 0.15
28 0.15
29 0.15
30 0.14
31 0.17
32 0.16
33 0.21
34 0.25
35 0.27
36 0.27
37 0.32
38 0.35
39 0.35
40 0.37
41 0.34
42 0.33
43 0.38
44 0.4
45 0.42
46 0.46
47 0.47
48 0.53
49 0.53
50 0.53
51 0.49
52 0.52
53 0.53
54 0.5
55 0.48
56 0.43
57 0.4
58 0.4
59 0.38
60 0.37
61 0.33
62 0.32
63 0.35
64 0.36
65 0.43
66 0.49
67 0.56
68 0.6
69 0.6
70 0.61
71 0.58
72 0.58
73 0.53
74 0.44
75 0.38
76 0.29
77 0.25
78 0.21
79 0.19
80 0.14
81 0.14
82 0.14
83 0.1
84 0.13
85 0.11
86 0.17
87 0.21
88 0.23
89 0.24
90 0.26
91 0.27
92 0.25
93 0.3
94 0.29
95 0.3
96 0.32
97 0.31
98 0.3
99 0.33
100 0.37
101 0.33
102 0.32
103 0.27
104 0.25
105 0.23
106 0.22
107 0.22
108 0.2
109 0.23
110 0.23
111 0.26
112 0.26
113 0.29
114 0.31
115 0.32
116 0.36
117 0.37
118 0.39
119 0.46
120 0.54
121 0.62
122 0.67
123 0.7
124 0.74
125 0.69
126 0.68
127 0.61
128 0.53
129 0.46
130 0.39
131 0.33
132 0.26
133 0.24
134 0.2
135 0.16
136 0.15
137 0.11
138 0.14
139 0.11
140 0.1
141 0.11
142 0.13
143 0.12
144 0.1
145 0.1
146 0.07
147 0.07
148 0.06
149 0.09
150 0.07
151 0.08
152 0.11
153 0.13
154 0.14
155 0.16
156 0.21
157 0.2
158 0.28
159 0.38
160 0.44
161 0.53
162 0.63
163 0.72
164 0.78
165 0.86
166 0.89
167 0.9
168 0.92
169 0.91
170 0.9
171 0.87
172 0.81
173 0.72
174 0.63
175 0.54
176 0.47
177 0.38
178 0.35
179 0.31
180 0.28
181 0.25
182 0.31
183 0.32
184 0.33
185 0.38
186 0.4
187 0.42
188 0.46
189 0.56