Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W3XMH2

Protein Details
Accession W3XMH2    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
114-142AITASVPHPRPPRRRRRRRLRAAAPEFWEHydrophilic
NLS Segment(s)
PositionSequence
121-135HPRPPRRRRRRRLRA
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
KEGG pfy:PFICI_00520  -  
Amino Acid Sequences MEKIPSTEGALSAPGRRHYQYSTLTDAPVNINQMGNPVWLNKATFRQLAEGALNNGTTTLPTVFTQEMMALQHRMFNGLVAFHDMAFNSSMPLPDDIVRTNIHHLPLLPPAAAAITASVPHPRPPRRRRRRRLRAAAPEFWEEEAALLHFMKNLEEEAALLEFIKNMGICPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.27
3 0.29
4 0.31
5 0.31
6 0.37
7 0.4
8 0.4
9 0.43
10 0.4
11 0.4
12 0.37
13 0.35
14 0.3
15 0.25
16 0.23
17 0.17
18 0.16
19 0.15
20 0.16
21 0.15
22 0.13
23 0.12
24 0.11
25 0.11
26 0.12
27 0.14
28 0.14
29 0.18
30 0.21
31 0.22
32 0.22
33 0.23
34 0.23
35 0.23
36 0.22
37 0.19
38 0.16
39 0.15
40 0.14
41 0.11
42 0.11
43 0.09
44 0.07
45 0.07
46 0.06
47 0.07
48 0.07
49 0.1
50 0.09
51 0.1
52 0.1
53 0.09
54 0.09
55 0.09
56 0.1
57 0.08
58 0.08
59 0.1
60 0.1
61 0.11
62 0.1
63 0.1
64 0.09
65 0.08
66 0.08
67 0.08
68 0.09
69 0.07
70 0.08
71 0.07
72 0.07
73 0.08
74 0.08
75 0.06
76 0.06
77 0.06
78 0.07
79 0.07
80 0.08
81 0.08
82 0.09
83 0.09
84 0.11
85 0.12
86 0.12
87 0.15
88 0.16
89 0.15
90 0.14
91 0.14
92 0.14
93 0.16
94 0.16
95 0.12
96 0.1
97 0.1
98 0.09
99 0.09
100 0.07
101 0.05
102 0.04
103 0.04
104 0.05
105 0.08
106 0.09
107 0.16
108 0.24
109 0.33
110 0.43
111 0.54
112 0.65
113 0.73
114 0.84
115 0.89
116 0.92
117 0.95
118 0.96
119 0.96
120 0.95
121 0.95
122 0.92
123 0.87
124 0.8
125 0.71
126 0.61
127 0.5
128 0.4
129 0.28
130 0.21
131 0.15
132 0.11
133 0.09
134 0.08
135 0.08
136 0.09
137 0.09
138 0.09
139 0.1
140 0.1
141 0.1
142 0.09
143 0.1
144 0.1
145 0.1
146 0.09
147 0.09
148 0.08
149 0.07
150 0.07
151 0.09
152 0.07