Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W3X4Q5

Protein Details
Accession W3X4Q5    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
303-335AAHLSKRGLVRNKLKMRRRDKSKPTDPIDPKQMHydrophilic
NLS Segment(s)
PositionSequence
308-325KRGLVRNKLKMRRRDKSK
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
KEGG pfy:PFICI_05991  -  
Amino Acid Sequences MFDNFTFHQVEEVHRTRHHVDDANKSEPHLSPNNDYDPVDWFSPQATPATTKYRPTEEDSSSQHGSSNSDSGSGSTGIDHIVRQMSRQTLLPYVRSNGQVRAVSHMEDVSTEWPSLDDDPISSFAMPFRRTQLQVPRAALRNMYRATPQTPDAPAQETTSPAEHAAAEVASDASRSPAHHQFLPQPETPAEPTSSNPRAIREALVESMIAHGVQCNVQSNPLPAASTDPGVLVGGKVQAKADQPMLDAGAVQGLSDSLEVGDPLADNEELAFMCKLASLRQAGKPSGIRRANGLNYRSSAEAAAHLSKRGLVRNKLKMRRRDKSKPTDPIDPKQMLTPPPEEDTAMPIVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.41
3 0.41
4 0.45
5 0.47
6 0.45
7 0.46
8 0.52
9 0.57
10 0.58
11 0.55
12 0.5
13 0.48
14 0.42
15 0.42
16 0.38
17 0.36
18 0.36
19 0.41
20 0.45
21 0.43
22 0.42
23 0.37
24 0.34
25 0.33
26 0.28
27 0.22
28 0.18
29 0.17
30 0.17
31 0.17
32 0.14
33 0.13
34 0.15
35 0.19
36 0.27
37 0.29
38 0.34
39 0.37
40 0.41
41 0.43
42 0.47
43 0.49
44 0.45
45 0.49
46 0.48
47 0.5
48 0.46
49 0.42
50 0.37
51 0.31
52 0.29
53 0.25
54 0.23
55 0.17
56 0.16
57 0.16
58 0.14
59 0.15
60 0.13
61 0.11
62 0.09
63 0.09
64 0.09
65 0.09
66 0.09
67 0.09
68 0.12
69 0.12
70 0.13
71 0.17
72 0.18
73 0.19
74 0.21
75 0.21
76 0.23
77 0.26
78 0.28
79 0.26
80 0.27
81 0.29
82 0.31
83 0.31
84 0.27
85 0.31
86 0.3
87 0.29
88 0.32
89 0.3
90 0.26
91 0.24
92 0.22
93 0.16
94 0.13
95 0.14
96 0.1
97 0.1
98 0.09
99 0.08
100 0.08
101 0.1
102 0.1
103 0.1
104 0.08
105 0.07
106 0.09
107 0.11
108 0.11
109 0.1
110 0.09
111 0.11
112 0.16
113 0.17
114 0.16
115 0.19
116 0.22
117 0.24
118 0.3
119 0.37
120 0.39
121 0.42
122 0.44
123 0.44
124 0.42
125 0.41
126 0.39
127 0.31
128 0.3
129 0.26
130 0.25
131 0.23
132 0.22
133 0.23
134 0.22
135 0.22
136 0.19
137 0.2
138 0.2
139 0.19
140 0.2
141 0.19
142 0.18
143 0.17
144 0.15
145 0.15
146 0.14
147 0.13
148 0.1
149 0.1
150 0.08
151 0.07
152 0.07
153 0.05
154 0.04
155 0.04
156 0.04
157 0.03
158 0.04
159 0.03
160 0.04
161 0.05
162 0.06
163 0.1
164 0.16
165 0.18
166 0.19
167 0.21
168 0.25
169 0.3
170 0.34
171 0.3
172 0.27
173 0.25
174 0.26
175 0.26
176 0.22
177 0.17
178 0.13
179 0.14
180 0.2
181 0.22
182 0.24
183 0.23
184 0.24
185 0.25
186 0.25
187 0.25
188 0.19
189 0.18
190 0.15
191 0.14
192 0.12
193 0.1
194 0.09
195 0.08
196 0.06
197 0.04
198 0.04
199 0.05
200 0.05
201 0.06
202 0.08
203 0.08
204 0.1
205 0.11
206 0.12
207 0.13
208 0.12
209 0.12
210 0.1
211 0.13
212 0.13
213 0.12
214 0.11
215 0.1
216 0.1
217 0.1
218 0.09
219 0.05
220 0.05
221 0.08
222 0.09
223 0.09
224 0.09
225 0.12
226 0.13
227 0.15
228 0.17
229 0.14
230 0.14
231 0.14
232 0.14
233 0.12
234 0.1
235 0.08
236 0.07
237 0.06
238 0.05
239 0.05
240 0.04
241 0.04
242 0.04
243 0.04
244 0.03
245 0.04
246 0.04
247 0.04
248 0.04
249 0.04
250 0.04
251 0.06
252 0.06
253 0.06
254 0.06
255 0.07
256 0.06
257 0.08
258 0.08
259 0.06
260 0.06
261 0.08
262 0.08
263 0.09
264 0.13
265 0.16
266 0.2
267 0.26
268 0.31
269 0.3
270 0.35
271 0.39
272 0.39
273 0.45
274 0.44
275 0.4
276 0.39
277 0.45
278 0.48
279 0.49
280 0.48
281 0.41
282 0.39
283 0.41
284 0.38
285 0.32
286 0.25
287 0.18
288 0.18
289 0.18
290 0.22
291 0.2
292 0.21
293 0.2
294 0.23
295 0.25
296 0.31
297 0.36
298 0.4
299 0.48
300 0.58
301 0.68
302 0.75
303 0.81
304 0.83
305 0.86
306 0.87
307 0.87
308 0.88
309 0.88
310 0.89
311 0.91
312 0.91
313 0.86
314 0.86
315 0.84
316 0.81
317 0.8
318 0.71
319 0.62
320 0.57
321 0.56
322 0.49
323 0.46
324 0.42
325 0.36
326 0.37
327 0.37
328 0.34
329 0.29
330 0.29