Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W3WGP8

Protein Details
Accession W3WGP8    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
7-33SSWTRGYKTCSRKREAKRRPTKLGGCSHydrophilic
NLS Segment(s)
PositionSequence
19-25KREAKRR
Subcellular Location(s) nucl 15, mito_nucl 12.833, mito 9.5, cyto_nucl 9.333
Family & Domain DBs
KEGG pfy:PFICI_15275  -  
Amino Acid Sequences MRRGSCSSWTRGYKTCSRKREAKRRPTKLGGCSMERQSMGERRPGEAMGGEQGSRTSMEIATVLGTCRKEQQYWMQRCLNLRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.66
3 0.65
4 0.67
5 0.72
6 0.77
7 0.83
8 0.84
9 0.84
10 0.86
11 0.87
12 0.88
13 0.87
14 0.83
15 0.77
16 0.76
17 0.68
18 0.61
19 0.56
20 0.5
21 0.43
22 0.36
23 0.31
24 0.25
25 0.26
26 0.24
27 0.25
28 0.23
29 0.22
30 0.23
31 0.22
32 0.19
33 0.14
34 0.13
35 0.09
36 0.09
37 0.08
38 0.07
39 0.07
40 0.08
41 0.08
42 0.07
43 0.07
44 0.06
45 0.07
46 0.07
47 0.07
48 0.07
49 0.07
50 0.08
51 0.1
52 0.11
53 0.12
54 0.19
55 0.21
56 0.22
57 0.26
58 0.36
59 0.44
60 0.5
61 0.56
62 0.56
63 0.56